Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 91451..92022 | Replicon | plasmid 2 |
| Accession | NZ_LR135436 | ||
| Organism | Enterococcus faecium isolate E8691 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | EQB50_RS14020 | Protein ID | WP_002322675.1 |
| Coordinates | 91681..92022 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | EQB50_RS14015 | Protein ID | WP_002322676.1 |
| Coordinates | 91451..91681 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB50_RS13990 | 86523..87077 | - | 555 | WP_002295761.1 | tyrosine-type recombinase/integrase | - |
| EQB50_RS13995 | 87820..88380 | + | 561 | WP_002347210.1 | hypothetical protein | - |
| EQB50_RS14000 | 88413..89225 | - | 813 | WP_002322679.1 | AAA family ATPase | - |
| EQB50_RS14005 | 89218..90654 | - | 1437 | WP_002322678.1 | DDE-type integrase/transposase/recombinase | - |
| EQB50_RS14010 | 90626..91219 | - | 594 | WP_002322677.1 | recombinase family protein | - |
| EQB50_RS14015 | 91451..91681 | + | 231 | WP_002322676.1 | hypothetical protein | Antitoxin |
| EQB50_RS14020 | 91681..92022 | + | 342 | WP_002322675.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EQB50_RS14025 | 92236..93738 | - | 1503 | WP_002322674.1 | xylulokinase | - |
| EQB50_RS14030 | 93811..94863 | - | 1053 | WP_002323515.1 | sugar ABC transporter substrate-binding protein | - |
| EQB50_RS14035 | 94916..95884 | - | 969 | WP_002322672.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..144068 | 144068 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13232.43 Da Isoelectric Point: 9.4128
>T288208 WP_002322675.1 NZ_LR135436:91681-92022 [Enterococcus faecium]
MTEEKNYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIRNFPTRYSLPTELDTTGQILISQ
LKSLDFNERKLKKIESLPLQDMAKIDQMIEYIF
MTEEKNYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIRNFPTRYSLPTELDTTGQILISQ
LKSLDFNERKLKKIESLPLQDMAKIDQMIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|