Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 113472..114079 | Replicon | plasmid 2 |
Accession | NZ_LR135420 | ||
Organism | Enterococcus faecium isolate E8440 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | E3USU0 |
Locus tag | FQ475_RS15090 | Protein ID | WP_002321032.1 |
Coordinates | 113729..114079 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A829F3C0 |
Locus tag | FQ475_RS15085 | Protein ID | WP_002287514.1 |
Coordinates | 113472..113735 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FQ475_RS15045 | 108508..109407 | + | 900 | WP_010733696.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
FQ475_RS15050 | 109410..109907 | + | 498 | WP_048946612.1 | single-stranded DNA-binding protein | - |
FQ475_RS15055 | 110273..110533 | + | 261 | WP_002296240.1 | hypothetical protein | - |
FQ475_RS15060 | 110978..111184 | + | 207 | WP_002325537.1 | hypothetical protein | - |
FQ475_RS15065 | 111205..111435 | + | 231 | WP_010726736.1 | hypothetical protein | - |
FQ475_RS15070 | 111451..111888 | + | 438 | WP_002332738.1 | hypothetical protein | - |
FQ475_RS15075 | 111881..112588 | + | 708 | WP_002332739.1 | hypothetical protein | - |
FQ475_RS15080 | 112968..113147 | + | 180 | WP_002305761.1 | hypothetical protein | - |
FQ475_RS15085 | 113472..113735 | + | 264 | WP_002287514.1 | hypothetical protein | Antitoxin |
FQ475_RS15090 | 113729..114079 | + | 351 | WP_002321032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
FQ475_RS15095 | 114103..114717 | - | 615 | WP_002318230.1 | recombinase family protein | - |
FQ475_RS15100 | 115031..115453 | + | 423 | WP_002288787.1 | hypothetical protein | - |
FQ475_RS15105 | 115463..115666 | + | 204 | WP_002299573.1 | hypothetical protein | - |
FQ475_RS15110 | 115877..116461 | + | 585 | WP_002299575.1 | recombinase family protein | - |
FQ475_RS15115 | 116745..117425 | - | 681 | WP_010861579.1 | IS6-like element IS1216 family transposase | - |
FQ475_RS15120 | 117744..118616 | - | 873 | WP_002305879.1 | ROK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | dfrG | - | 1..245801 | 245801 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13255.28 Da Isoelectric Point: 8.0280
>T288200 WP_002321032.1 NZ_LR135420:113729-114079 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F5H8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F3C0 |