Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 113472..114079 Replicon plasmid 2
Accession NZ_LR135420
Organism Enterococcus faecium isolate E8440

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag FQ475_RS15090 Protein ID WP_002321032.1
Coordinates 113729..114079 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag FQ475_RS15085 Protein ID WP_002287514.1
Coordinates 113472..113735 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FQ475_RS15045 108508..109407 + 900 WP_010733696.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
FQ475_RS15050 109410..109907 + 498 WP_048946612.1 single-stranded DNA-binding protein -
FQ475_RS15055 110273..110533 + 261 WP_002296240.1 hypothetical protein -
FQ475_RS15060 110978..111184 + 207 WP_002325537.1 hypothetical protein -
FQ475_RS15065 111205..111435 + 231 WP_010726736.1 hypothetical protein -
FQ475_RS15070 111451..111888 + 438 WP_002332738.1 hypothetical protein -
FQ475_RS15075 111881..112588 + 708 WP_002332739.1 hypothetical protein -
FQ475_RS15080 112968..113147 + 180 WP_002305761.1 hypothetical protein -
FQ475_RS15085 113472..113735 + 264 WP_002287514.1 hypothetical protein Antitoxin
FQ475_RS15090 113729..114079 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
FQ475_RS15095 114103..114717 - 615 WP_002318230.1 recombinase family protein -
FQ475_RS15100 115031..115453 + 423 WP_002288787.1 hypothetical protein -
FQ475_RS15105 115463..115666 + 204 WP_002299573.1 hypothetical protein -
FQ475_RS15110 115877..116461 + 585 WP_002299575.1 recombinase family protein -
FQ475_RS15115 116745..117425 - 681 WP_010861579.1 IS6-like element IS1216 family transposase -
FQ475_RS15120 117744..118616 - 873 WP_002305879.1 ROK family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid dfrG - 1..245801 245801


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288200 WP_002321032.1 NZ_LR135420:113729-114079 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288200 WP_002287514.1 NZ_LR135420:113472-113735 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References