Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 529199..529770 | Replicon | chromosome |
| Accession | NZ_LR135419 | ||
| Organism | Enterococcus faecium isolate E8440 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | FQ475_RS02535 | Protein ID | WP_002286801.1 |
| Coordinates | 529429..529770 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | FQ475_RS02530 | Protein ID | WP_002323011.1 |
| Coordinates | 529199..529429 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FQ475_RS02505 | 524332..525663 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
| FQ475_RS02510 | 525685..526311 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
| FQ475_RS02515 | 526494..527075 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
| FQ475_RS02520 | 527807..528369 | + | 563 | Protein_500 | SOS response-associated peptidase family protein | - |
| FQ475_RS02525 | 528574..528912 | - | 339 | WP_002286804.1 | hypothetical protein | - |
| FQ475_RS02530 | 529199..529429 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| FQ475_RS02535 | 529429..529770 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| FQ475_RS02540 | 530620..530805 | + | 186 | WP_002304207.1 | hypothetical protein | - |
| FQ475_RS02545 | 531310..531504 | + | 195 | WP_002297028.1 | hypothetical protein | - |
| FQ475_RS02550 | 531695..531944 | + | 250 | Protein_506 | transposase | - |
| FQ475_RS02555 | 532188..533018 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
| FQ475_RS02560 | 533226..534560 | + | 1335 | WP_002286788.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T288199 WP_002286801.1 NZ_LR135419:529429-529770 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |