Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 34003..35140 | Replicon | plasmid 3 |
Accession | NZ_LR135410 | ||
Organism | Enterococcus faecium isolate E8284 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | EQB56_RS16635 | Protein ID | WP_074394525.1 |
Coordinates | 34003..34866 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL01 |
Locus tag | EQB56_RS16640 | Protein ID | WP_002331065.1 |
Coordinates | 34868..35140 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB56_RS16605 | 30206..30325 | - | 120 | Protein_31 | recombinase family protein | - |
EQB56_RS16610 | 30341..30946 | - | 606 | WP_000599739.1 | cell filamentation protein | - |
EQB56_RS16615 | 31347..31964 | - | 618 | WP_099124473.1 | FtsX-like permease family protein | - |
EQB56_RS16620 | 31968..32648 | - | 681 | WP_001067799.1 | IS6-like element IS1216 family transposase | - |
EQB56_RS16625 | 32795..32878 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
EQB56_RS16630 | 33003..33740 | + | 738 | WP_002321849.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
EQB56_RS16635 | 34003..34866 | - | 864 | WP_074394525.1 | zeta toxin family protein | Toxin |
EQB56_RS16640 | 34868..35140 | - | 273 | WP_002331065.1 | antitoxin | Antitoxin |
EQB56_RS16645 | 35157..35366 | - | 210 | WP_000527318.1 | peptide-binding protein | - |
EQB56_RS16650 | 35465..36361 | - | 897 | WP_002334978.1 | ParA family protein | - |
EQB56_RS16660 | 36659..37231 | - | 573 | WP_001079938.1 | HTH domain-containing protein | - |
EQB56_RS16670 | 37507..38301 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
EQB56_RS16675 | 38394..38936 | - | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
EQB56_RS16680 | 38933..39841 | - | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | VanHBX / erm(B) / aph(3')-III / ant(6)-Ia | - | 1..63798 | 63798 | |
- | inside | IScluster/Tn | VanHBX / erm(B) / aph(3')-III / ant(6)-Ia | - | 22860..39841 | 16981 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32611.17 Da Isoelectric Point: 6.6627
>T288193 WP_074394525.1 NZ_LR135410:c34866-34003 [Enterococcus faecium]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSKGYETKIYVMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQLPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSKGYETKIYVMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQLPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|