Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 45447..46054 Replicon plasmid 2
Accession NZ_LR135409
Organism Enterococcus faecium isolate E8284

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag EQB56_RS15355 Protein ID WP_002321032.1
Coordinates 45704..46054 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag EQB56_RS15350 Protein ID WP_002287514.1
Coordinates 45447..45710 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB56_RS15305 40483..41382 + 900 WP_010733696.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
EQB56_RS15310 41385..41882 + 498 WP_048946612.1 single-stranded DNA-binding protein -
EQB56_RS15315 42248..42508 + 261 WP_002296240.1 hypothetical protein -
EQB56_RS15320 42953..43159 + 207 WP_002325537.1 hypothetical protein -
EQB56_RS15325 43207..43410 + 204 WP_110300627.1 hypothetical protein -
EQB56_RS15330 43426..43863 + 438 WP_002332738.1 hypothetical protein -
EQB56_RS15335 43856..44563 + 708 WP_002332739.1 hypothetical protein -
EQB56_RS15345 44943..45122 + 180 WP_002305761.1 hypothetical protein -
EQB56_RS15350 45447..45710 + 264 WP_002287514.1 hypothetical protein Antitoxin
EQB56_RS15355 45704..46054 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB56_RS15360 46078..46692 - 615 WP_002318230.1 recombinase family protein -
EQB56_RS15365 47006..47428 + 423 WP_002288787.1 hypothetical protein -
EQB56_RS15370 47438..47641 + 204 WP_002299573.1 hypothetical protein -
EQB56_RS15375 47852..48436 + 585 WP_002299575.1 recombinase family protein -
EQB56_RS15380 48720..49400 - 681 WP_010861579.1 IS6-like element IS1216 family transposase -
EQB56_RS15385 49674..50546 - 873 WP_002305879.1 ROK family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-aph(2'') - 1..239811 239811


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288192 WP_002321032.1 NZ_LR135409:45704-46054 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288192 WP_002287514.1 NZ_LR135409:45447-45710 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References