Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 52690..53827 | Replicon | plasmid 3 |
Accession | NZ_LR135403 | ||
Organism | Enterococcus faecium isolate E8377 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | EQB54_RS16760 | Protein ID | WP_074394525.1 |
Coordinates | 52690..53553 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL01 |
Locus tag | EQB54_RS16765 | Protein ID | WP_002331065.1 |
Coordinates | 53555..53827 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB54_RS16730 | 48893..49012 | - | 120 | Protein_53 | recombinase family protein | - |
EQB54_RS16735 | 49028..49633 | - | 606 | WP_000599739.1 | cell filamentation protein | - |
EQB54_RS16740 | 50034..50651 | - | 618 | WP_099124473.1 | FtsX-like permease family protein | - |
EQB54_RS16745 | 50655..51335 | - | 681 | WP_001067799.1 | IS6-like element IS1216 family transposase | - |
EQB54_RS16750 | 51482..51565 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
EQB54_RS16755 | 51690..52427 | + | 738 | WP_002321849.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
EQB54_RS16760 | 52690..53553 | - | 864 | WP_074394525.1 | zeta toxin family protein | Toxin |
EQB54_RS16765 | 53555..53827 | - | 273 | WP_002331065.1 | antitoxin | Antitoxin |
EQB54_RS16770 | 53844..54053 | - | 210 | WP_000527318.1 | peptide-binding protein | - |
EQB54_RS16775 | 54152..55048 | - | 897 | WP_002334978.1 | ParA family protein | - |
EQB54_RS16785 | 55346..55918 | - | 573 | WP_001079938.1 | HTH domain-containing protein | - |
EQB54_RS16795 | 56194..56988 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
EQB54_RS16800 | 57081..57623 | - | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
EQB54_RS16805 | 57620..58528 | - | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | VanHBX / erm(B) / aph(3')-III / ant(6)-Ia | - | 1..63798 | 63798 | |
- | inside | IScluster/Tn | VanHBX / erm(B) / aph(3')-III / ant(6)-Ia | - | 41547..58528 | 16981 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32611.17 Da Isoelectric Point: 6.6627
>T288188 WP_074394525.1 NZ_LR135403:c53553-52690 [Enterococcus faecium]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSKGYETKIYVMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQLPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSKGYETKIYVMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQLPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|