Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 45447..46054 | Replicon | plasmid 2 |
Accession | NZ_LR135402 | ||
Organism | Enterococcus faecium isolate E8377 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | E3USU0 |
Locus tag | EQB54_RS15380 | Protein ID | WP_002321032.1 |
Coordinates | 45704..46054 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A829F3C0 |
Locus tag | EQB54_RS15375 | Protein ID | WP_002287514.1 |
Coordinates | 45447..45710 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB54_RS15330 | 40483..41382 | + | 900 | WP_010733696.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
EQB54_RS15335 | 41385..41882 | + | 498 | WP_048946612.1 | single-stranded DNA-binding protein | - |
EQB54_RS15340 | 42248..42508 | + | 261 | WP_002296240.1 | hypothetical protein | - |
EQB54_RS15345 | 42953..43159 | + | 207 | WP_002325537.1 | hypothetical protein | - |
EQB54_RS15350 | 43207..43410 | + | 204 | WP_110300627.1 | hypothetical protein | - |
EQB54_RS15355 | 43426..43863 | + | 438 | WP_002332738.1 | hypothetical protein | - |
EQB54_RS15360 | 43856..44563 | + | 708 | WP_002332739.1 | hypothetical protein | - |
EQB54_RS15370 | 44943..45122 | + | 180 | WP_002305761.1 | hypothetical protein | - |
EQB54_RS15375 | 45447..45710 | + | 264 | WP_002287514.1 | hypothetical protein | Antitoxin |
EQB54_RS15380 | 45704..46054 | + | 351 | WP_002321032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EQB54_RS15385 | 46078..46692 | - | 615 | WP_002318230.1 | recombinase family protein | - |
EQB54_RS15390 | 47006..47428 | + | 423 | WP_002288787.1 | hypothetical protein | - |
EQB54_RS15395 | 47438..47641 | + | 204 | WP_002299573.1 | hypothetical protein | - |
EQB54_RS15400 | 47852..48436 | + | 585 | WP_002299575.1 | recombinase family protein | - |
EQB54_RS15405 | 48720..49400 | - | 681 | WP_010861579.1 | IS6-like element IS1216 family transposase | - |
EQB54_RS15410 | 49674..50546 | - | 873 | WP_002305879.1 | ROK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(6')-aph(2'') | - | 1..239811 | 239811 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13255.28 Da Isoelectric Point: 8.0280
>T288187 WP_002321032.1 NZ_LR135402:45704-46054 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F5H8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F3C0 |