Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 7089..8226 | Replicon | plasmid 4 |
| Accession | NZ_LR135387 | ||
| Organism | Enterococcus faecium isolate E7933 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | - |
| Locus tag | EQB43_RS16940 | Protein ID | WP_074394525.1 |
| Coordinates | 7089..7952 (-) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL01 |
| Locus tag | EQB43_RS16945 | Protein ID | WP_002331065.1 |
| Coordinates | 7954..8226 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB43_RS16910 | 3292..3411 | - | 120 | Protein_5 | recombinase family protein | - |
| EQB43_RS16915 | 3427..4032 | - | 606 | WP_000599739.1 | cell filamentation protein | - |
| EQB43_RS16920 | 4433..5050 | - | 618 | WP_099124473.1 | FtsX-like permease family protein | - |
| EQB43_RS16925 | 5054..5734 | - | 681 | WP_001067799.1 | IS6-like element IS1216 family transposase | - |
| EQB43_RS16930 | 5881..5964 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| EQB43_RS16935 | 6089..6826 | + | 738 | WP_002321849.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| EQB43_RS16940 | 7089..7952 | - | 864 | WP_074394525.1 | zeta toxin family protein | Toxin |
| EQB43_RS16945 | 7954..8226 | - | 273 | WP_002331065.1 | antitoxin | Antitoxin |
| EQB43_RS16950 | 8243..8452 | - | 210 | WP_000527318.1 | peptide-binding protein | - |
| EQB43_RS16955 | 8551..9447 | - | 897 | WP_002334978.1 | ParA family protein | - |
| EQB43_RS16965 | 9745..10317 | - | 573 | WP_001079938.1 | HTH domain-containing protein | - |
| EQB43_RS16975 | 10593..11387 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
| EQB43_RS16980 | 11480..12022 | - | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
| EQB43_RS16985 | 12019..12927 | - | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | erm(B) / aph(3')-III / ant(6)-Ia / VanHBX | - | 1..62379 | 62379 | |
| - | inside | IS/Tn | erm(B) / aph(3')-III / ant(6)-Ia | - | 5054..12927 | 7873 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32611.17 Da Isoelectric Point: 6.6627
>T288178 WP_074394525.1 NZ_LR135387:c7952-7089 [Enterococcus faecium]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSKGYETKIYVMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQLPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSKGYETKIYVMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQLPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|