Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 54429..54948 Replicon plasmid 3
Accession NZ_LR135386
Organism Enterococcus faecium isolate E7933

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag EQB43_RS16765 Protein ID WP_000588503.1
Coordinates 54691..54948 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag EQB43_RS16760 Protein ID WP_000388479.1
Coordinates 54429..54698 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB43_RS16705 49626..50525 + 900 WP_002303312.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
EQB43_RS16710 50528..51013 + 486 WP_002303313.1 single-stranded DNA-binding protein -
EQB43_RS16715 51154..51357 - 204 WP_002316074.1 putative holin-like toxin -
EQB43_RS16720 51432..51692 + 261 WP_002295623.1 hypothetical protein -
EQB43_RS16730 52129..52335 + 207 WP_002347218.1 hypothetical protein -
EQB43_RS16735 52335..52586 + 252 WP_002296238.1 hypothetical protein -
EQB43_RS16740 52601..53038 + 438 WP_002300851.1 hypothetical protein -
EQB43_RS16745 53031..53738 + 708 WP_002303117.1 hypothetical protein -
EQB43_RS16755 54119..54298 + 180 WP_001120991.1 hypothetical protein -
EQB43_RS16760 54429..54698 + 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EQB43_RS16765 54691..54948 + 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
EQB43_RS17655 55407..55562 + 156 WP_002347142.1 hypothetical protein -
EQB43_RS16770 55586..56410 + 825 WP_001809248.1 hypothetical protein -
EQB43_RS16775 56575..57189 - 615 WP_001261742.1 recombinase family protein -
EQB43_RS16780 57427..57849 + 423 WP_002303116.1 hypothetical protein -
EQB43_RS16785 57859..58062 + 204 WP_002299573.1 hypothetical protein -
EQB43_RS16790 58078..59037 - 960 WP_002303350.1 IS30 family transposase -
EQB43_RS16795 59339..59923 + 585 WP_002299575.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..70572 70572


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T288177 WP_000588503.1 NZ_LR135386:54691-54948 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT288177 WP_000388479.1 NZ_LR135386:54429-54698 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References