Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 48197..48804 Replicon plasmid 2
Accession NZ_LR135385
Organism Enterococcus faecium isolate E7933

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag EQB43_RS15390 Protein ID WP_002321032.1
Coordinates 48454..48804 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag EQB43_RS15385 Protein ID WP_002287514.1
Coordinates 48197..48460 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB43_RS15340 43233..44132 + 900 WP_010733696.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
EQB43_RS15345 44135..44632 + 498 WP_048946612.1 single-stranded DNA-binding protein -
EQB43_RS15350 44998..45258 + 261 WP_002296240.1 hypothetical protein -
EQB43_RS15355 45703..45909 + 207 WP_002325537.1 hypothetical protein -
EQB43_RS15360 45957..46160 + 204 WP_110300627.1 hypothetical protein -
EQB43_RS15365 46176..46613 + 438 WP_002332738.1 hypothetical protein -
EQB43_RS15370 46606..47313 + 708 WP_002332739.1 hypothetical protein -
EQB43_RS15380 47693..47872 + 180 WP_002305761.1 hypothetical protein -
EQB43_RS15385 48197..48460 + 264 WP_002287514.1 hypothetical protein Antitoxin
EQB43_RS15390 48454..48804 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB43_RS15395 48828..49442 - 615 WP_002318230.1 recombinase family protein -
EQB43_RS15400 49756..50178 + 423 WP_002288787.1 hypothetical protein -
EQB43_RS15405 50188..50391 + 204 WP_002299573.1 hypothetical protein -
EQB43_RS15410 50602..51186 + 585 WP_002299575.1 recombinase family protein -
EQB43_RS15415 51470..52150 - 681 WP_010861579.1 IS6-like element IS1216 family transposase -
EQB43_RS15420 52225..52866 + 642 Protein_56 GH32 C-terminal domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-aph(2'') - 1..238264 238264


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288176 WP_002321032.1 NZ_LR135385:48454-48804 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288176 WP_002287514.1 NZ_LR135385:48197-48460 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References