Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 45293..45900 Replicon plasmid 3
Accession NZ_LR135374
Organism Enterococcus faecium isolate E8172

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag EQB36_RS14790 Protein ID WP_002321032.1
Coordinates 45550..45900 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag EQB36_RS14785 Protein ID WP_002287514.1
Coordinates 45293..45556 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB36_RS14745 40604..40864 + 261 WP_002296240.1 hypothetical protein -
EQB36_RS14750 41309..41515 + 207 WP_002325537.1 hypothetical protein -
EQB36_RS14755 41563..41766 + 204 WP_110300627.1 hypothetical protein -
EQB36_RS14760 41782..42219 + 438 WP_002332738.1 hypothetical protein -
EQB36_RS14765 42212..42919 + 708 WP_002332739.1 hypothetical protein -
EQB36_RS14775 43299..43478 + 180 WP_002305761.1 hypothetical protein -
EQB36_RS14780 43812..44999 - 1188 WP_002296840.1 IS256-like element IS16 family transposase -
EQB36_RS14785 45293..45556 + 264 WP_002287514.1 hypothetical protein Antitoxin
EQB36_RS14790 45550..45900 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB36_RS14795 45924..46538 - 615 WP_002318230.1 recombinase family protein -
EQB36_RS14800 46852..47274 + 423 WP_002288787.1 hypothetical protein -
EQB36_RS14805 47284..47487 + 204 WP_002299573.1 hypothetical protein -
EQB36_RS14810 47698..48282 + 585 WP_002299575.1 recombinase family protein -
EQB36_RS14815 48653..49978 + 1326 WP_071245491.1 Y-family DNA polymerase -
EQB36_RS14820 49971..50321 + 351 WP_112019300.1 hypothetical protein -
EQB36_RS14825 50318..50497 + 180 WP_071244496.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid erm(B) / VanHAX - 1..88799 88799
- flank IS/Tn - - 43812..44999 1187


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288173 WP_002321032.1 NZ_LR135374:45550-45900 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288173 WP_002287514.1 NZ_LR135374:45293-45556 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References