Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 524752..525323 Replicon chromosome
Accession NZ_LR135372
Organism Enterococcus faecium isolate E8172

Toxin (Protein)


Gene name mazF Uniprot ID Q3Y2B8
Locus tag EQB36_RS02675 Protein ID WP_002286801.1
Coordinates 524982..525323 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A828ZZN9
Locus tag EQB36_RS02670 Protein ID WP_002323011.1
Coordinates 524752..524982 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB36_RS02620 519885..521216 + 1332 WP_002286818.1 FAD-containing oxidoreductase -
EQB36_RS02625 521238..521864 + 627 WP_002286816.1 cysteine hydrolase -
EQB36_RS02630 522047..522628 + 582 WP_002286813.1 TetR/AcrR family transcriptional regulator -
EQB36_RS02650 523360..523707 + 348 WP_002286808.1 SOS response-associated peptidase family protein -
EQB36_RS02655 523683..523922 + 240 WP_002321938.1 SOS response-associated peptidase family protein -
EQB36_RS02660 524127..524465 - 339 WP_002286804.1 hypothetical protein -
EQB36_RS02670 524752..524982 + 231 WP_002323011.1 hypothetical protein Antitoxin
EQB36_RS02675 524982..525323 + 342 WP_002286801.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB36_RS02680 526173..526358 + 186 WP_002304207.1 hypothetical protein -
EQB36_RS02685 526863..527057 + 195 WP_002297028.1 hypothetical protein -
EQB36_RS02690 527215..527497 + 283 Protein_498 transposase -
EQB36_RS02700 527741..528571 - 831 WP_002286789.1 manganese catalase family protein -
EQB36_RS02705 528779..530113 + 1335 WP_002286788.1 ABC transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-113)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13302.68 Da        Isoelectric Point: 9.9044

>T288171 WP_002286801.1 NZ_LR135372:524982-525323 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8523.39 Da        Isoelectric Point: 3.9078

>AT288171 WP_002323011.1 NZ_LR135372:524752-524982 [Enterococcus faecium]
MLVTKSRLQGSSVVVTLPSDNGKKPSENQEYIVVYSDDGTITLVPKIEDPFSGGEEAEYYEKDEWEDLTPEGREIL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FD66

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZZN9

References