Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 7819..8338 Replicon plasmid 3
Accession NZ_LR135359
Organism Enterococcus faecium isolate E7948

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag EQB40_RS15220 Protein ID WP_000588503.1
Coordinates 8081..8338 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag EQB40_RS15215 Protein ID WP_000388479.1
Coordinates 7819..8088 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB40_RS15170 3097..3513 - 417 WP_127820675.1 hypothetical protein -
EQB40_RS15175 3515..3796 - 282 WP_002368064.1 hypothetical protein -
EQB40_RS15180 4141..4386 + 246 WP_002311817.1 hypothetical protein -
EQB40_RS15185 4688..4783 - 96 WP_106913803.1 type I toxin-antitoxin system Fst family toxin -
EQB40_RS15190 5458..5640 + 183 Protein_7 RepB family plasmid replication initiator protein -
EQB40_RS15195 5691..6371 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
EQB40_RS15200 6433..7128 + 696 WP_002326819.1 hypothetical protein -
EQB40_RS15210 7509..7688 + 180 WP_001120991.1 hypothetical protein -
EQB40_RS15215 7819..8088 + 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EQB40_RS15220 8081..8338 + 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
EQB40_RS15225 8797..9555 + 759 Protein_13 hypothetical protein -
EQB40_RS15230 9801..11000 + 1200 WP_002317296.1 helix-turn-helix domain-containing protein -
EQB40_RS15235 11022..11234 + 213 WP_002317295.1 DUF5348 domain-containing protein -
EQB40_RS15240 11309..11785 + 477 WP_002317294.1 PcfB family protein -
EQB40_RS15245 11782..12831 + 1050 Protein_17 type IV secretory system conjugative DNA transfer family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid VanHBX - 1..51724 51724


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T288165 WP_000588503.1 NZ_LR135359:8081-8338 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT288165 WP_000388479.1 NZ_LR135359:7819-8088 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References