Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 18235..19343 | Replicon | plasmid 3 |
Accession | NZ_LR135353 | ||
Organism | Enterococcus faecium isolate E8014 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | R3JIN1 |
Locus tag | EQB45_RS16200 | Protein ID | WP_000233000.1 |
Coordinates | 18474..19343 (+) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | EQB45_RS16195 | Protein ID | WP_000205227.1 |
Coordinates | 18235..18459 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB45_RS16165 | 13501..14340 | + | 840 | Protein_14 | type IA DNA topoisomerase | - |
EQB45_RS16170 | 14417..15097 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
EQB45_RS16175 | 15437..16606 | - | 1170 | WP_002300493.1 | IS256 family transposase | - |
EQB45_RS16180 | 16844..17092 | + | 249 | Protein_17 | Gfo/Idh/MocA family oxidoreductase | - |
EQB45_RS16185 | 17166..17846 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
EQB45_RS16190 | 17901..18092 | + | 192 | Protein_19 | recombinase family protein | - |
EQB45_RS16195 | 18235..18459 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
EQB45_RS16200 | 18474..19343 | + | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
EQB45_RS16205 | 19324..20058 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
EQB45_RS16210 | 20091..20999 | + | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
EQB45_RS16215 | 20996..21476 | + | 481 | Protein_24 | GNAT family N-acetyltransferase | - |
EQB45_RS16220 | 21621..21622 | - | 2 | WP_164852608.1 | IS6-like element IS1216 family transposase | - |
EQB45_RS16225 | 22452..22664 | + | 213 | WP_002349227.1 | hypothetical protein | - |
EQB45_RS16230 | 22826..23344 | + | 519 | WP_000357244.1 | YfbU family protein | - |
EQB45_RS16235 | 23351..23863 | + | 513 | WP_000774078.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T288160 WP_000233000.1 NZ_LR135353:18474-19343 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|