Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 47596..48203 | Replicon | plasmid 2 |
Accession | NZ_LR135352 | ||
Organism | Enterococcus faecium isolate E8014 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | E3USU0 |
Locus tag | EQB45_RS14930 | Protein ID | WP_002321032.1 |
Coordinates | 47853..48203 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A829F3C0 |
Locus tag | EQB45_RS14925 | Protein ID | WP_002287514.1 |
Coordinates | 47596..47859 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB45_RS14875 | 42632..43531 | + | 900 | WP_002322787.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
EQB45_RS14880 | 43534..44019 | + | 486 | WP_002296241.1 | single-stranded DNA-binding protein | - |
EQB45_RS14885 | 44385..44645 | + | 261 | WP_002296240.1 | hypothetical protein | - |
EQB45_RS14895 | 45086..45292 | + | 207 | WP_002296239.1 | hypothetical protein | - |
EQB45_RS14900 | 45292..45543 | + | 252 | WP_002296238.1 | hypothetical protein | - |
EQB45_RS14905 | 45558..45995 | + | 438 | WP_002296237.1 | hypothetical protein | - |
EQB45_RS14910 | 45988..46695 | + | 708 | WP_002353391.1 | hypothetical protein | - |
EQB45_RS14920 | 47076..47255 | + | 180 | WP_002305761.1 | hypothetical protein | - |
EQB45_RS14925 | 47596..47859 | + | 264 | WP_002287514.1 | hypothetical protein | Antitoxin |
EQB45_RS14930 | 47853..48203 | + | 351 | WP_002321032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EQB45_RS14935 | 48227..48841 | - | 615 | WP_010729795.1 | recombinase family protein | - |
EQB45_RS14940 | 49155..49577 | + | 423 | WP_002288787.1 | hypothetical protein | - |
EQB45_RS14945 | 49587..49790 | + | 204 | WP_002299573.1 | hypothetical protein | - |
EQB45_RS14950 | 50001..50585 | + | 585 | WP_002299575.1 | recombinase family protein | - |
EQB45_RS14955 | 50774..51454 | - | 681 | WP_010861579.1 | IS6-like element IS1216 family transposase | - |
EQB45_RS14960 | 51508..52218 | - | 711 | WP_010729797.1 | GntR family transcriptional regulator | - |
EQB45_RS14965 | 52202..52936 | - | 735 | WP_010729798.1 | GntR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(B) / aac(6')-aph(2'') | - | 1..238961 | 238961 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13255.28 Da Isoelectric Point: 8.0280
>T288157 WP_002321032.1 NZ_LR135352:47853-48203 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F5H8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F3C0 |