Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2456655..2457226 | Replicon | chromosome |
Accession | NZ_LR135351 | ||
Organism | Enterococcus faecium isolate E8014 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q3Y2B8 |
Locus tag | EQB45_RS12600 | Protein ID | WP_002286801.1 |
Coordinates | 2456655..2456996 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | EQB45_RS12605 | Protein ID | WP_002323011.1 |
Coordinates | 2456996..2457226 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB45_RS12570 | 2451865..2453199 | - | 1335 | WP_002286788.1 | ABC transporter substrate-binding protein | - |
EQB45_RS12575 | 2453407..2454237 | + | 831 | WP_002286789.1 | manganese catalase family protein | - |
EQB45_RS12585 | 2454481..2454763 | - | 283 | Protein_2341 | transposase | - |
EQB45_RS12590 | 2454921..2455115 | - | 195 | WP_002297028.1 | hypothetical protein | - |
EQB45_RS12595 | 2455620..2455805 | - | 186 | WP_002304207.1 | hypothetical protein | - |
EQB45_RS12600 | 2456655..2456996 | - | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EQB45_RS12605 | 2456996..2457226 | - | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
EQB45_RS12615 | 2457513..2457851 | + | 339 | WP_002286804.1 | hypothetical protein | - |
EQB45_RS12620 | 2458056..2458295 | - | 240 | WP_002321938.1 | SOS response-associated peptidase family protein | - |
EQB45_RS12625 | 2458271..2458618 | - | 348 | WP_002286808.1 | SOS response-associated peptidase family protein | - |
EQB45_RS12645 | 2459350..2459931 | - | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
EQB45_RS12650 | 2460114..2460740 | - | 627 | WP_002286816.1 | cysteine hydrolase | - |
EQB45_RS12655 | 2460762..2462093 | - | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T288156 WP_002286801.1 NZ_LR135351:c2456996-2456655 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FD66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |