Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 2456655..2457226 Replicon chromosome
Accession NZ_LR135351
Organism Enterococcus faecium isolate E8014

Toxin (Protein)


Gene name mazF Uniprot ID Q3Y2B8
Locus tag EQB45_RS12600 Protein ID WP_002286801.1
Coordinates 2456655..2456996 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A828ZZN9
Locus tag EQB45_RS12605 Protein ID WP_002323011.1
Coordinates 2456996..2457226 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB45_RS12570 2451865..2453199 - 1335 WP_002286788.1 ABC transporter substrate-binding protein -
EQB45_RS12575 2453407..2454237 + 831 WP_002286789.1 manganese catalase family protein -
EQB45_RS12585 2454481..2454763 - 283 Protein_2341 transposase -
EQB45_RS12590 2454921..2455115 - 195 WP_002297028.1 hypothetical protein -
EQB45_RS12595 2455620..2455805 - 186 WP_002304207.1 hypothetical protein -
EQB45_RS12600 2456655..2456996 - 342 WP_002286801.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB45_RS12605 2456996..2457226 - 231 WP_002323011.1 hypothetical protein Antitoxin
EQB45_RS12615 2457513..2457851 + 339 WP_002286804.1 hypothetical protein -
EQB45_RS12620 2458056..2458295 - 240 WP_002321938.1 SOS response-associated peptidase family protein -
EQB45_RS12625 2458271..2458618 - 348 WP_002286808.1 SOS response-associated peptidase family protein -
EQB45_RS12645 2459350..2459931 - 582 WP_002286813.1 TetR/AcrR family transcriptional regulator -
EQB45_RS12650 2460114..2460740 - 627 WP_002286816.1 cysteine hydrolase -
EQB45_RS12655 2460762..2462093 - 1332 WP_002286818.1 FAD-containing oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-113)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13302.68 Da        Isoelectric Point: 9.9044

>T288156 WP_002286801.1 NZ_LR135351:c2456996-2456655 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8523.39 Da        Isoelectric Point: 3.9078

>AT288156 WP_002323011.1 NZ_LR135351:c2457226-2456996 [Enterococcus faecium]
MLVTKSRLQGSSVVVTLPSDNGKKPSENQEYIVVYSDDGTITLVPKIEDPFSGGEEAEYYEKDEWEDLTPEGREIL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FD66

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZZN9

References