Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 11891..12999 | Replicon | plasmid 4 |
Accession | NZ_LR135342 | ||
Organism | Enterococcus faecium isolate E7356 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | - |
Locus tag | EQB70_RS16515 | Protein ID | WP_060763469.1 |
Coordinates | 12130..12999 (+) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | EQB70_RS16510 | Protein ID | WP_000205227.1 |
Coordinates | 11891..12115 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB70_RS16900 | 7480..7650 | + | 171 | WP_000713595.1 | hypothetical protein | - |
EQB70_RS16485 | 7664..8266 | + | 603 | WP_001062586.1 | recombinase family protein | - |
EQB70_RS16490 | 8282..8959 | + | 678 | Protein_10 | DNA topoisomerase | - |
EQB70_RS16495 | 9471..9767 | + | 297 | WP_002360685.1 | hypothetical protein | - |
EQB70_RS16500 | 9768..10184 | + | 417 | WP_000323438.1 | recombinase | - |
EQB70_RS16505 | 10186..11748 | + | 1563 | WP_000136908.1 | recombinase family protein | - |
EQB70_RS16510 | 11891..12115 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
EQB70_RS16515 | 12130..12999 | + | 870 | WP_060763469.1 | nucleotidyltransferase domain-containing protein | Toxin |
EQB70_RS16520 | 12980..13714 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
EQB70_RS16525 | 13747..14655 | + | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
EQB70_RS16530 | 14652..15194 | + | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
EQB70_RS16535 | 15287..16081 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
EQB70_RS16545 | 16357..16929 | + | 573 | WP_001079938.1 | HTH domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | ant(6)-Ia / aph(3')-III / erm(B) | - | 1..28557 | 28557 | |
- | inside | IS/Tn | ant(6)-Ia / aph(3')-III / erm(B) | - | 13747..21620 | 7873 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32777.35 Da Isoelectric Point: 4.7269
>T288150 WP_060763469.1 NZ_LR135342:12130-12999 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGAEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGAEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|