Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 198026..198633 | Replicon | plasmid 2 |
Accession | NZ_LR135340 | ||
Organism | Enterococcus faecium isolate E7356 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | E3USU0 |
Locus tag | EQB70_RS15900 | Protein ID | WP_002321032.1 |
Coordinates | 198026..198376 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A829F3C0 |
Locus tag | EQB70_RS15905 | Protein ID | WP_002287514.1 |
Coordinates | 198370..198633 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB70_RS15870 | 193489..194361 | + | 873 | WP_002292418.1 | ROK family protein | - |
EQB70_RS15875 | 194680..195360 | + | 681 | WP_010861579.1 | IS6-like element IS1216 family transposase | - |
EQB70_RS15880 | 195644..196228 | - | 585 | WP_002299575.1 | recombinase family protein | - |
EQB70_RS15885 | 196439..196642 | - | 204 | WP_002299573.1 | hypothetical protein | - |
EQB70_RS15890 | 196652..197074 | - | 423 | WP_002288787.1 | hypothetical protein | - |
EQB70_RS15895 | 197388..198002 | + | 615 | WP_002318230.1 | recombinase family protein | - |
EQB70_RS15900 | 198026..198376 | - | 351 | WP_002321032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EQB70_RS15905 | 198370..198633 | - | 264 | WP_002287514.1 | hypothetical protein | Antitoxin |
EQB70_RS15910 | 198958..199137 | - | 180 | WP_127843816.1 | hypothetical protein | - |
EQB70_RS15920 | 199517..200224 | - | 708 | WP_002332739.1 | hypothetical protein | - |
EQB70_RS15925 | 200217..200654 | - | 438 | WP_002332738.1 | hypothetical protein | - |
EQB70_RS15930 | 200670..200921 | - | 252 | WP_002287517.1 | hypothetical protein | - |
EQB70_RS15935 | 200921..201127 | - | 207 | WP_002325537.1 | hypothetical protein | - |
EQB70_RS15940 | 201572..201832 | - | 261 | WP_002296240.1 | hypothetical protein | - |
EQB70_RS15945 | 202198..202695 | - | 498 | WP_048946612.1 | single-stranded DNA-binding protein | - |
EQB70_RS15950 | 202698..203597 | - | 900 | WP_010733696.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..234907 | 234907 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13255.28 Da Isoelectric Point: 8.0280
>T288149 WP_002321032.1 NZ_LR135340:c198376-198026 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F5H8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F3C0 |