Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 198026..198633 Replicon plasmid 2
Accession NZ_LR135340
Organism Enterococcus faecium isolate E7356

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag EQB70_RS15900 Protein ID WP_002321032.1
Coordinates 198026..198376 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag EQB70_RS15905 Protein ID WP_002287514.1
Coordinates 198370..198633 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB70_RS15870 193489..194361 + 873 WP_002292418.1 ROK family protein -
EQB70_RS15875 194680..195360 + 681 WP_010861579.1 IS6-like element IS1216 family transposase -
EQB70_RS15880 195644..196228 - 585 WP_002299575.1 recombinase family protein -
EQB70_RS15885 196439..196642 - 204 WP_002299573.1 hypothetical protein -
EQB70_RS15890 196652..197074 - 423 WP_002288787.1 hypothetical protein -
EQB70_RS15895 197388..198002 + 615 WP_002318230.1 recombinase family protein -
EQB70_RS15900 198026..198376 - 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB70_RS15905 198370..198633 - 264 WP_002287514.1 hypothetical protein Antitoxin
EQB70_RS15910 198958..199137 - 180 WP_127843816.1 hypothetical protein -
EQB70_RS15920 199517..200224 - 708 WP_002332739.1 hypothetical protein -
EQB70_RS15925 200217..200654 - 438 WP_002332738.1 hypothetical protein -
EQB70_RS15930 200670..200921 - 252 WP_002287517.1 hypothetical protein -
EQB70_RS15935 200921..201127 - 207 WP_002325537.1 hypothetical protein -
EQB70_RS15940 201572..201832 - 261 WP_002296240.1 hypothetical protein -
EQB70_RS15945 202198..202695 - 498 WP_048946612.1 single-stranded DNA-binding protein -
EQB70_RS15950 202698..203597 - 900 WP_010733696.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..234907 234907


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288149 WP_002321032.1 NZ_LR135340:c198376-198026 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288149 WP_002287514.1 NZ_LR135340:c198633-198370 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References