Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 25335..26472 | Replicon | plasmid 4 |
| Accession | NZ_LR135327 | ||
| Organism | Enterococcus faecium isolate E7654 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | Q54944 |
| Locus tag | EQB39_RS15865 | Protein ID | WP_001284311.1 |
| Coordinates | 25609..26472 (+) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | R2XCR7 |
| Locus tag | EQB39_RS15860 | Protein ID | WP_000301765.1 |
| Coordinates | 25335..25607 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB39_RS15830 | 21022..22398 | - | 1377 | WP_001574277.1 | tetracycline efflux MFS transporter Tet(L) | - |
| EQB39_RS15835 | 22432..22482 | - | 51 | Protein_25 | tetracycline resistance efflux system leader peptide | - |
| EQB39_RS15840 | 22592..23956 | - | 1365 | Protein_26 | TetM/TetW/TetO/TetS family tetracycline resistance ribosomal protection protein | - |
| EQB39_RS15845 | 24018..24698 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| EQB39_RS15850 | 24754..25011 | + | 258 | WP_002347171.1 | hypothetical protein | - |
| EQB39_RS15855 | 25109..25318 | + | 210 | WP_000527318.1 | peptide-binding protein | - |
| EQB39_RS15860 | 25335..25607 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
| EQB39_RS15865 | 25609..26472 | + | 864 | WP_001284311.1 | toxin zeta | Toxin |
| EQB39_RS15870 | 26735..27472 | - | 738 | WP_001038796.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| EQB39_RS15875 | 27597..27680 | - | 84 | WP_031929417.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
| EQB39_RS15880 | 27729..27812 | - | 84 | Protein_34 | peptide-binding protein | - |
| EQB39_RS15885 | 28222..29016 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
| EQB39_RS15890 | 29109..29360 | - | 252 | Protein_36 | GNAT family N-acetyltransferase | - |
| EQB39_RS15895 | 29605..30900 | + | 1296 | WP_002297218.1 | ISL3-like element ISEfa11 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | lsa(E) / tet(L) / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) | - | 1..38929 | 38929 | |
| - | inside | IScluster/Tn | lsa(E) / tet(L) / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) | - | 10..38885 | 38875 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32404.02 Da Isoelectric Point: 6.9964
>T288142 WP_001284311.1 NZ_LR135327:25609-26472 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 1GVN | |
| PDB | 3Q8X |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3Q8X | |
| PDB | 1GVN | |
| AlphaFold DB | A0A829F0A3 |