Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 48395..48914 Replicon plasmid 3
Accession NZ_LR135326
Organism Enterococcus faecium isolate E7654

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag EQB39_RS15605 Protein ID WP_000588503.1
Coordinates 48657..48914 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag EQB39_RS15600 Protein ID WP_000388479.1
Coordinates 48395..48664 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB39_RS15545 43592..44491 + 900 WP_002303312.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
EQB39_RS15550 44494..44979 + 486 WP_002303313.1 single-stranded DNA-binding protein -
EQB39_RS15555 45120..45323 - 204 WP_002316074.1 putative holin-like toxin -
EQB39_RS15560 45398..45658 + 261 WP_002295623.1 hypothetical protein -
EQB39_RS15570 46095..46301 + 207 WP_002347218.1 hypothetical protein -
EQB39_RS15575 46301..46552 + 252 WP_002296238.1 hypothetical protein -
EQB39_RS15580 46567..47004 + 438 WP_002300851.1 hypothetical protein -
EQB39_RS15585 46997..47704 + 708 WP_002303117.1 hypothetical protein -
EQB39_RS15595 48085..48264 + 180 WP_001120991.1 hypothetical protein -
EQB39_RS15600 48395..48664 + 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EQB39_RS15605 48657..48914 + 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
EQB39_RS16245 49373..49528 + 156 WP_002347142.1 hypothetical protein -
EQB39_RS15610 49552..50376 + 825 WP_001809248.1 hypothetical protein -
EQB39_RS15615 50541..51155 - 615 WP_001261742.1 recombinase family protein -
EQB39_RS15620 51393..51815 + 423 WP_002303116.1 hypothetical protein -
EQB39_RS15625 51825..52028 + 204 WP_002299573.1 hypothetical protein -
EQB39_RS15630 52240..52824 + 585 WP_002299575.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..61971 61971


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T288141 WP_000588503.1 NZ_LR135326:48657-48914 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT288141 WP_000388479.1 NZ_LR135326:48395-48664 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References