Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 13932..15069 | Replicon | plasmid 4 |
Accession | NZ_LR135320 | ||
Organism | Enterococcus faecium isolate E7663 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | Q54944 |
Locus tag | EQB37_RS15515 | Protein ID | WP_001284311.1 |
Coordinates | 14206..15069 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | EQB37_RS15510 | Protein ID | WP_000301765.1 |
Coordinates | 13932..14204 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB37_RS15480 | 9619..10995 | - | 1377 | WP_001574277.1 | tetracycline efflux MFS transporter Tet(L) | - |
EQB37_RS15485 | 11029..11079 | - | 51 | Protein_10 | tetracycline resistance efflux system leader peptide | - |
EQB37_RS15490 | 11189..12553 | - | 1365 | Protein_11 | TetM/TetW/TetO/TetS family tetracycline resistance ribosomal protection protein | - |
EQB37_RS15495 | 12615..13295 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
EQB37_RS15500 | 13351..13608 | + | 258 | WP_002347171.1 | hypothetical protein | - |
EQB37_RS15505 | 13706..13915 | + | 210 | WP_000527318.1 | peptide-binding protein | - |
EQB37_RS15510 | 13932..14204 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
EQB37_RS15515 | 14206..15069 | + | 864 | WP_001284311.1 | toxin zeta | Toxin |
EQB37_RS15520 | 15332..16069 | - | 738 | WP_001038796.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
EQB37_RS15525 | 16194..16277 | - | 84 | WP_031929417.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
EQB37_RS15530 | 16326..16409 | - | 84 | Protein_19 | peptide-binding protein | - |
EQB37_RS15535 | 16819..17613 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
EQB37_RS15540 | 17706..17957 | - | 252 | Protein_21 | GNAT family N-acetyltransferase | - |
EQB37_RS15545 | 18202..19497 | + | 1296 | WP_002297218.1 | ISL3-like element ISEfa11 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | tet(L) / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) | - | 1..38929 | 38929 | |
- | inside | IScluster/Tn | tet(L) / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) | - | 3290..37645 | 34355 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32404.02 Da Isoelectric Point: 6.9964
>T288136 WP_001284311.1 NZ_LR135320:14206-15069 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 1GVN | |
PDB | 3Q8X |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3Q8X | |
PDB | 1GVN | |
AlphaFold DB | A0A829F0A3 |