Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 26376..26983 Replicon plasmid 3
Accession NZ_LR135309
Organism Enterococcus faecium isolate E7240

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag EQB75_RS16520 Protein ID WP_002321032.1
Coordinates 26633..26983 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag EQB75_RS16515 Protein ID WP_002287514.1
Coordinates 26376..26639 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB75_RS16470 21399..21659 + 261 WP_002321303.1 hypothetical protein -
EQB75_RS16475 22104..22310 + 207 WP_002296239.1 hypothetical protein -
EQB75_RS16480 22310..22561 + 252 WP_002305766.1 hypothetical protein -
EQB75_RS16485 22577..22993 + 417 WP_002305764.1 hypothetical protein -
EQB75_RS16490 22975..23610 + 636 WP_002305763.1 hypothetical protein -
EQB75_RS16500 23991..24170 + 180 WP_002305761.1 hypothetical protein -
EQB75_RS16505 24580..24981 + 402 WP_002305759.1 IS200/IS605 family transposase -
EQB75_RS16510 24993..26138 + 1146 WP_002305757.1 IS200/IS605 family element transposase accessory protein TnpB -
EQB75_RS16515 26376..26639 + 264 WP_002287514.1 hypothetical protein Antitoxin
EQB75_RS16520 26633..26983 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB75_RS16525 27007..27621 - 615 WP_002318230.1 recombinase family protein -
EQB75_RS16530 27935..28357 + 423 WP_002288787.1 hypothetical protein -
EQB75_RS16535 28367..28570 + 204 WP_002299573.1 hypothetical protein -
EQB75_RS16540 28781..29365 + 585 WP_002299575.1 recombinase family protein -
EQB75_RS16545 29534..30859 + 1326 WP_000969590.1 Y-family DNA polymerase -
EQB75_RS16550 30852..31202 + 351 WP_002303114.1 hypothetical protein -
EQB75_RS16555 31199..31378 + 180 WP_002322386.1 hypothetical protein -
EQB75_RS16560 31390..31683 + 294 WP_002322251.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..55609 55609


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288129 WP_002321032.1 NZ_LR135309:26633-26983 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288129 WP_002287514.1 NZ_LR135309:26376-26639 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References