Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 19452..20589 | Replicon | plasmid 4 |
| Accession | NZ_LR135300 | ||
| Organism | Enterococcus faecium isolate E7429 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | - |
| Locus tag | EQB73_RS16860 | Protein ID | WP_074394525.1 |
| Coordinates | 19452..20315 (-) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL01 |
| Locus tag | EQB73_RS16865 | Protein ID | WP_002331065.1 |
| Coordinates | 20317..20589 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB73_RS16825 | 14693..14950 | + | 258 | WP_002326781.1 | hypothetical protein | - |
| EQB73_RS16830 | 15202..15774 | - | 573 | WP_000170424.1 | recombinase family protein | - |
| EQB73_RS16835 | 15790..16395 | - | 606 | WP_000599739.1 | cell filamentation protein | - |
| EQB73_RS16840 | 16796..17413 | - | 618 | WP_099124473.1 | FtsX-like permease family protein | - |
| EQB73_RS16845 | 17417..18097 | - | 681 | WP_001067799.1 | IS6-like element IS1216 family transposase | - |
| EQB73_RS16850 | 18244..18327 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| EQB73_RS16855 | 18452..19189 | + | 738 | WP_002321849.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| EQB73_RS16860 | 19452..20315 | - | 864 | WP_074394525.1 | zeta toxin family protein | Toxin |
| EQB73_RS16865 | 20317..20589 | - | 273 | WP_002331065.1 | antitoxin | Antitoxin |
| EQB73_RS16870 | 20606..20815 | - | 210 | WP_000527318.1 | peptide-binding protein | - |
| EQB73_RS16875 | 20914..21810 | - | 897 | WP_002334978.1 | ParA family protein | - |
| EQB73_RS16885 | 22108..22680 | - | 573 | WP_001079938.1 | HTH domain-containing protein | - |
| EQB73_RS16895 | 22956..23750 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
| EQB73_RS16900 | 23843..24385 | - | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
| EQB73_RS16905 | 24382..25290 | - | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | erm(B) / aph(3')-III / ant(6)-Ia | - | 1..28557 | 28557 | |
| - | inside | IS/Tn | erm(B) / aph(3')-III / ant(6)-Ia | - | 17417..25290 | 7873 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32611.17 Da Isoelectric Point: 6.6627
>T288126 WP_074394525.1 NZ_LR135300:c20315-19452 [Enterococcus faecium]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSKGYETKIYVMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQLPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSKGYETKIYVMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQLPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|