Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 231239..231908 Replicon plasmid 2
Accession NZ_LR135294
Organism Enterococcus faecium isolate E7237

Toxin (Protein)


Gene name zeta Uniprot ID -
Locus tag EQB69_RS15105 Protein ID WP_010708525.1
Coordinates 231239..231634 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL01
Locus tag EQB69_RS15110 Protein ID WP_002331065.1
Coordinates 231636..231908 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB69_RS15070 226970..227698 - 729 WP_010726886.1 hypothetical protein -
EQB69_RS15075 227958..228506 - 549 WP_002292681.1 hypothetical protein -
EQB69_RS15080 228507..229364 - 858 WP_002292680.1 AAA family ATPase -
EQB69_RS15085 229650..229937 - 288 WP_002300557.1 type II toxin-antitoxin system RelE/ParE family toxin -
EQB69_RS15090 229927..230256 - 330 WP_002292678.1 AbrB family transcriptional regulator -
EQB69_RS15095 230333..230479 - 147 Protein_239 Txe/YoeB family addiction module toxin -
EQB69_RS15100 230531..231211 - 681 Protein_240 IS6 family transposase -
EQB69_RS15105 231239..231634 - 396 WP_010708525.1 zeta toxin family protein Toxin
EQB69_RS15110 231636..231908 - 273 WP_002331065.1 antitoxin Antitoxin
EQB69_RS15115 231925..232134 - 210 WP_000527318.1 peptide-binding protein -
EQB69_RS15120 232233..233129 - 897 WP_002334978.1 ParA family protein -
EQB69_RS15125 233373..234668 + 1296 WP_002326809.1 ISL3-like element ISEfa5 family transposase -
EQB69_RS15135 234949..235521 - 573 WP_001079938.1 HTH domain-containing protein -
EQB69_RS15145 235797..236591 - 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid erm(B) / aac(6')-aph(2'') / aph(3')-III - 1..256017 256017
- inside IScluster/Tn aph(3')-III - 225349..241632 16283


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(28-118)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14867.86 Da        Isoelectric Point: 5.2505

>T288122 WP_010708525.1 NZ_LR135294:c231634-231239 [Enterococcus faecium]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGFCCKVLNLLSNKVE

Download         Length: 396 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10733.17 Da        Isoelectric Point: 4.4865

>AT288122 WP_002331065.1 NZ_LR135294:c231908-231636 [Enterococcus faecium]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILNKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZL55

References