Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 231239..231908 | Replicon | plasmid 2 |
| Accession | NZ_LR135294 | ||
| Organism | Enterococcus faecium isolate E7237 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | - |
| Locus tag | EQB69_RS15105 | Protein ID | WP_010708525.1 |
| Coordinates | 231239..231634 (-) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL01 |
| Locus tag | EQB69_RS15110 | Protein ID | WP_002331065.1 |
| Coordinates | 231636..231908 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB69_RS15070 | 226970..227698 | - | 729 | WP_010726886.1 | hypothetical protein | - |
| EQB69_RS15075 | 227958..228506 | - | 549 | WP_002292681.1 | hypothetical protein | - |
| EQB69_RS15080 | 228507..229364 | - | 858 | WP_002292680.1 | AAA family ATPase | - |
| EQB69_RS15085 | 229650..229937 | - | 288 | WP_002300557.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| EQB69_RS15090 | 229927..230256 | - | 330 | WP_002292678.1 | AbrB family transcriptional regulator | - |
| EQB69_RS15095 | 230333..230479 | - | 147 | Protein_239 | Txe/YoeB family addiction module toxin | - |
| EQB69_RS15100 | 230531..231211 | - | 681 | Protein_240 | IS6 family transposase | - |
| EQB69_RS15105 | 231239..231634 | - | 396 | WP_010708525.1 | zeta toxin family protein | Toxin |
| EQB69_RS15110 | 231636..231908 | - | 273 | WP_002331065.1 | antitoxin | Antitoxin |
| EQB69_RS15115 | 231925..232134 | - | 210 | WP_000527318.1 | peptide-binding protein | - |
| EQB69_RS15120 | 232233..233129 | - | 897 | WP_002334978.1 | ParA family protein | - |
| EQB69_RS15125 | 233373..234668 | + | 1296 | WP_002326809.1 | ISL3-like element ISEfa5 family transposase | - |
| EQB69_RS15135 | 234949..235521 | - | 573 | WP_001079938.1 | HTH domain-containing protein | - |
| EQB69_RS15145 | 235797..236591 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | erm(B) / aac(6')-aph(2'') / aph(3')-III | - | 1..256017 | 256017 | |
| - | inside | IScluster/Tn | aph(3')-III | - | 225349..241632 | 16283 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14867.86 Da Isoelectric Point: 5.2505
>T288122 WP_010708525.1 NZ_LR135294:c231634-231239 [Enterococcus faecium]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGFCCKVLNLLSNKVE
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGFCCKVLNLLSNKVE
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|