Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 41932..42582 | Replicon | plasmid 2 |
| Accession | NZ_LR135294 | ||
| Organism | Enterococcus faecium isolate E7237 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EQB69_RS14035 | Protein ID | WP_002332741.1 |
| Coordinates | 41932..42117 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A829EWE8 |
| Locus tag | EQB69_RS14040 | Protein ID | WP_002305052.1 |
| Coordinates | 42151..42582 (+) | Length | 144 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB69_RS13990 | 37237..38136 | + | 900 | WP_014401509.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| EQB69_RS13995 | 38139..38624 | + | 486 | WP_014401510.1 | single-stranded DNA-binding protein | - |
| EQB69_RS14000 | 38990..39250 | + | 261 | WP_002296240.1 | hypothetical protein | - |
| EQB69_RS14005 | 39697..39903 | + | 207 | WP_002296239.1 | hypothetical protein | - |
| EQB69_RS14010 | 39903..40127 | + | 225 | WP_020944759.1 | hypothetical protein | - |
| EQB69_RS14015 | 40142..40579 | + | 438 | WP_020944760.1 | hypothetical protein | - |
| EQB69_RS14020 | 40572..41279 | + | 708 | WP_020944761.1 | hypothetical protein | - |
| EQB69_RS14030 | 41660..41839 | + | 180 | WP_002295613.1 | hypothetical protein | - |
| EQB69_RS14035 | 41932..42117 | + | 186 | WP_002332741.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EQB69_RS14040 | 42151..42582 | + | 432 | WP_002305052.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EQB69_RS14050 | 43519..44658 | + | 1140 | Protein_45 | oligosaccharide MFS transporter | - |
| EQB69_RS14055 | 44734..45414 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| EQB69_RS14060 | 45470..47275 | + | 1806 | Protein_47 | TraM recognition domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | erm(B) / aac(6')-aph(2'') / aph(3')-III | - | 1..256017 | 256017 | |
| - | flank | IS/Tn | - | - | 44734..45414 | 680 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6969.15 Da Isoelectric Point: 10.6196
>T288120 WP_002332741.1 NZ_LR135294:41932-42117 [Enterococcus faecium]
MPLTGKEMLKLLKKNGWVERRQEGSHHHLYKDGVRITVPVHANQDLGRGLEQKILKDAGLK
MPLTGKEMLKLLKKNGWVERRQEGSHHHLYKDGVRITVPVHANQDLGRGLEQKILKDAGLK
Download Length: 186 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 15811.92 Da Isoelectric Point: 4.1638
>AT288120 WP_002305052.1 NZ_LR135294:42151-42582 [Enterococcus faecium]
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
Download Length: 432 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|