Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 12617..13224 Replicon plasmid 4
Accession NZ_LR135290
Organism Enterococcus faecium isolate E7199

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag EQB72_RS16145 Protein ID WP_002321032.1
Coordinates 12874..13224 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag EQB72_RS16140 Protein ID WP_002287514.1
Coordinates 12617..12880 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB72_RS16105 8133..8384 + 252 WP_127843688.1 streptothricin acetyltransferase -
EQB72_RS16110 8414..9094 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
EQB72_RS16115 9156..9851 + 696 WP_127843689.1 hypothetical protein -
EQB72_RS16125 10232..10411 + 180 WP_002305761.1 hypothetical protein -
EQB72_RS16130 10821..11222 + 402 WP_002305759.1 IS200/IS605 family transposase -
EQB72_RS16135 11234..12379 + 1146 WP_002305757.1 IS200/IS605 family element transposase accessory protein TnpB -
EQB72_RS16140 12617..12880 + 264 WP_002287514.1 hypothetical protein Antitoxin
EQB72_RS16145 12874..13224 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB72_RS16150 13248..13862 - 615 WP_002318230.1 recombinase family protein -
EQB72_RS16155 14176..14598 + 423 WP_002288787.1 hypothetical protein -
EQB72_RS16160 14608..14811 + 204 WP_002299573.1 hypothetical protein -
EQB72_RS16165 15022..15606 + 585 WP_002299575.1 recombinase family protein -
EQB72_RS16170 15775..17100 + 1326 WP_002303115.1 Y-family DNA polymerase -
EQB72_RS16175 17093..17443 + 351 WP_002303114.1 hypothetical protein -
EQB72_RS16180 17500..18180 - 681 WP_060797357.1 IS6-like element IS1216 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid erm(B) / ant(6)-Ia - 1..26053 26053
- inside IScluster/Tn erm(B) / ant(6)-Ia - 1657..24273 22616


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288117 WP_002321032.1 NZ_LR135290:12874-13224 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288117 WP_002287514.1 NZ_LR135290:12617-12880 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References