Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 513067..513638 | Replicon | chromosome |
| Accession | NZ_LR135287 | ||
| Organism | Enterococcus faecium isolate E7199 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | EQB72_RS02625 | Protein ID | WP_002286801.1 |
| Coordinates | 513297..513638 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | EQB72_RS02620 | Protein ID | WP_002323011.1 |
| Coordinates | 513067..513297 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB72_RS02570 | 508200..509531 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
| EQB72_RS02575 | 509553..510179 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
| EQB72_RS02580 | 510362..510943 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
| EQB72_RS02600 | 511675..512022 | + | 348 | WP_002286808.1 | SOS response-associated peptidase family protein | - |
| EQB72_RS02605 | 511998..512237 | + | 240 | WP_002321938.1 | SOS response-associated peptidase family protein | - |
| EQB72_RS02610 | 512442..512780 | - | 339 | WP_002286804.1 | hypothetical protein | - |
| EQB72_RS02620 | 513067..513297 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| EQB72_RS02625 | 513297..513638 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EQB72_RS02630 | 514488..514673 | + | 186 | WP_002304207.1 | hypothetical protein | - |
| EQB72_RS02635 | 515178..515372 | + | 195 | WP_002297028.1 | hypothetical protein | - |
| EQB72_RS02640 | 515494..515812 | + | 319 | Protein_487 | transposase | - |
| EQB72_RS02650 | 516056..516886 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
| EQB72_RS02655 | 517094..518428 | + | 1335 | WP_002303373.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T288116 WP_002286801.1 NZ_LR135287:513297-513638 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |