Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2641859..2642430 | Replicon | chromosome |
| Accession | NZ_LR135278 | ||
| Organism | Enterococcus faecium isolate E6975 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | EQB65_RS13635 | Protein ID | WP_002286801.1 |
| Coordinates | 2642089..2642430 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | EQB65_RS13630 | Protein ID | WP_002323011.1 |
| Coordinates | 2641859..2642089 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB65_RS13580 | 2636992..2638323 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
| EQB65_RS13585 | 2638345..2638971 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
| EQB65_RS13590 | 2639154..2639735 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
| EQB65_RS13610 | 2640467..2640814 | + | 348 | WP_002286808.1 | SOS response-associated peptidase family protein | - |
| EQB65_RS13615 | 2640790..2641029 | + | 240 | WP_002321938.1 | SOS response-associated peptidase family protein | - |
| EQB65_RS13620 | 2641234..2641572 | - | 339 | WP_002286804.1 | hypothetical protein | - |
| EQB65_RS13630 | 2641859..2642089 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| EQB65_RS13635 | 2642089..2642430 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EQB65_RS13640 | 2643280..2643465 | + | 186 | WP_002304207.1 | hypothetical protein | - |
| EQB65_RS13645 | 2643970..2644164 | + | 195 | WP_002297028.1 | hypothetical protein | - |
| EQB65_RS13650 | 2644322..2644604 | + | 283 | Protein_2511 | transposase | - |
| EQB65_RS13660 | 2644848..2645678 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
| EQB65_RS13665 | 2645886..2647220 | + | 1335 | WP_002303373.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T288111 WP_002286801.1 NZ_LR135278:2642089-2642430 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |