Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 48125..48732 | Replicon | plasmid 4 |
| Accession | NZ_LR135261 | ||
| Organism | Enterococcus faecium isolate E4457 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | E3USU0 |
| Locus tag | EQB59_RS15210 | Protein ID | WP_002321032.1 |
| Coordinates | 48125..48475 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A829F3C0 |
| Locus tag | EQB59_RS15215 | Protein ID | WP_002287514.1 |
| Coordinates | 48469..48732 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB59_RS15180 | 43141..43695 | - | 555 | WP_002323026.1 | hypothetical protein | - |
| EQB59_RS15185 | 43698..44540 | - | 843 | WP_002323027.1 | ParA family protein | - |
| EQB59_RS15190 | 44860..45153 | - | 294 | WP_002326890.1 | hypothetical protein | - |
| EQB59_RS15195 | 45369..45719 | - | 351 | WP_002323028.1 | hypothetical protein | - |
| EQB59_RS15200 | 45712..47037 | - | 1326 | WP_002319870.1 | Y-family DNA polymerase | - |
| EQB59_RS15205 | 47487..48101 | + | 615 | WP_002318230.1 | recombinase family protein | - |
| EQB59_RS15210 | 48125..48475 | - | 351 | WP_002321032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EQB59_RS15215 | 48469..48732 | - | 264 | WP_002287514.1 | hypothetical protein | Antitoxin |
| EQB59_RS15220 | 49073..49252 | - | 180 | WP_002305761.1 | hypothetical protein | - |
| EQB59_RS15230 | 49633..50340 | - | 708 | WP_127837488.1 | hypothetical protein | - |
| EQB59_RS15235 | 50333..50770 | - | 438 | WP_002296237.1 | hypothetical protein | - |
| EQB59_RS15240 | 50785..51036 | - | 252 | WP_002296238.1 | hypothetical protein | - |
| EQB59_RS15245 | 51036..51242 | - | 207 | WP_086328673.1 | DNA helicase UvrA | - |
| EQB59_RS15255 | 51683..51943 | - | 261 | WP_002296240.1 | hypothetical protein | - |
| EQB59_RS15260 | 52309..52794 | - | 486 | WP_002296241.1 | single-stranded DNA-binding protein | - |
| EQB59_RS15265 | 52797..53521 | - | 725 | WP_164856672.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..53521 | 53521 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13255.28 Da Isoelectric Point: 8.0280
>T288109 WP_002321032.1 NZ_LR135261:c48475-48125 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829F5H8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829F3C0 |