Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 24473..25581 | Replicon | plasmid 3 |
Accession | NZ_LR135260 | ||
Organism | Enterococcus faecium isolate E4457 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | A0A2I4SCC6 |
Locus tag | EQB59_RS14745 | Protein ID | WP_062810426.1 |
Coordinates | 24712..25581 (+) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | B9DSK1 |
Locus tag | EQB59_RS14740 | Protein ID | WP_002303393.1 |
Coordinates | 24473..24697 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB59_RS14720 | 19474..20037 | + | 564 | Protein_26 | zinc ribbon domain-containing protein | - |
EQB59_RS14725 | 20480..21964 | + | 1485 | WP_002294513.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
EQB59_RS14730 | 22018..22821 | + | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
EQB59_RS14735 | 23509..24330 | + | 822 | Protein_29 | recombinase zinc beta ribbon domain-containing protein | - |
EQB59_RS14740 | 24473..24697 | + | 225 | WP_002303393.1 | helix-turn-helix transcriptional regulator | Antitoxin |
EQB59_RS14745 | 24712..25581 | + | 870 | WP_062810426.1 | nucleotidyltransferase domain-containing protein | Toxin |
EQB59_RS14750 | 25562..26296 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
EQB59_RS14755 | 26329..27237 | + | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
EQB59_RS14760 | 27234..27776 | + | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
EQB59_RS14765 | 27869..28663 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
EQB59_RS14770 | 29073..29156 | + | 84 | Protein_36 | peptide-binding protein | - |
EQB59_RS14775 | 29205..29288 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
EQB59_RS14780 | 29413..30150 | + | 738 | WP_001038790.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32793.31 Da Isoelectric Point: 4.6575
>T288108 WP_062810426.1 NZ_LR135260:24712-25581 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARSTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGAEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYNEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARSTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGAEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYNEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I4SCC6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M5SHM7 |