Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 52069..52588 Replicon plasmid 4
Accession NZ_LR135257
Organism Enterococcus faecium isolate E7098

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag EQB68_RS16145 Protein ID WP_000588503.1
Coordinates 52331..52588 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag EQB68_RS16140 Protein ID WP_000388479.1
Coordinates 52069..52338 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB68_RS16085 47266..48165 + 900 WP_002303312.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
EQB68_RS16090 48168..48653 + 486 WP_002303313.1 single-stranded DNA-binding protein -
EQB68_RS16095 48794..48997 - 204 WP_002316074.1 putative holin-like toxin -
EQB68_RS16100 49072..49332 + 261 WP_002295623.1 hypothetical protein -
EQB68_RS16110 49769..49975 + 207 WP_002347218.1 hypothetical protein -
EQB68_RS16115 49975..50226 + 252 WP_002296238.1 hypothetical protein -
EQB68_RS16120 50241..50678 + 438 WP_002300851.1 hypothetical protein -
EQB68_RS16125 50671..51378 + 708 WP_002303117.1 hypothetical protein -
EQB68_RS16135 51759..51938 + 180 WP_001120991.1 hypothetical protein -
EQB68_RS16140 52069..52338 + 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EQB68_RS16145 52331..52588 + 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
EQB68_RS16440 53047..53202 + 156 WP_002347142.1 hypothetical protein -
EQB68_RS16150 53226..54050 + 825 WP_001809248.1 hypothetical protein -
EQB68_RS16155 54215..54829 - 615 WP_001261742.1 recombinase family protein -
EQB68_RS16160 55067..55489 + 423 WP_002303116.1 hypothetical protein -
EQB68_RS16165 55499..55702 + 204 WP_002299573.1 hypothetical protein -
EQB68_RS16170 55913..56497 + 585 WP_002299575.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..66958 66958


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T288102 WP_000588503.1 NZ_LR135257:52331-52588 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT288102 WP_000388479.1 NZ_LR135257:52069-52338 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References