Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 471891..472462 | Replicon | chromosome |
Accession | NZ_LR135254 | ||
Organism | Enterococcus faecium isolate E7098 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q3Y2B8 |
Locus tag | EQB68_RS02395 | Protein ID | WP_002286801.1 |
Coordinates | 472121..472462 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | EQB68_RS02390 | Protein ID | WP_002323011.1 |
Coordinates | 471891..472121 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB68_RS02340 | 467024..468355 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
EQB68_RS02345 | 468377..469003 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
EQB68_RS02350 | 469186..469767 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
EQB68_RS02370 | 470499..470846 | + | 348 | WP_002286808.1 | SOS response-associated peptidase family protein | - |
EQB68_RS02375 | 470822..471061 | + | 240 | WP_002321938.1 | SOS response-associated peptidase family protein | - |
EQB68_RS02380 | 471266..471604 | - | 339 | WP_002286804.1 | hypothetical protein | - |
EQB68_RS02390 | 471891..472121 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
EQB68_RS02395 | 472121..472462 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EQB68_RS02400 | 473312..473497 | + | 186 | WP_002304207.1 | hypothetical protein | - |
EQB68_RS02405 | 474002..474196 | + | 195 | WP_002297028.1 | hypothetical protein | - |
EQB68_RS02410 | 474318..474636 | + | 319 | Protein_444 | transposase | - |
EQB68_RS02420 | 474880..475710 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
EQB68_RS02425 | 475918..477252 | + | 1335 | WP_002303373.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T288098 WP_002286801.1 NZ_LR135254:472121-472462 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FD66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |