Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 39127..40264 | Replicon | plasmid 5 |
Accession | NZ_LR135247 | ||
Organism | Enterococcus faecium isolate E6988 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | Q54944 |
Locus tag | EQB64_RS16520 | Protein ID | WP_001284311.1 |
Coordinates | 39401..40264 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | EQB64_RS16515 | Protein ID | WP_000301765.1 |
Coordinates | 39127..39399 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB64_RS16490 | 35625..37118 | + | 1494 | WP_000947691.1 | primase C-terminal domain-containing protein | - |
EQB64_RS16495 | 37253..37549 | + | 297 | WP_000053907.1 | replication control protein PrgN | - |
EQB64_RS16500 | 37573..38532 | - | 960 | WP_002287225.1 | IS30 family transposase | - |
EQB64_RS16505 | 38552..38803 | + | 252 | Protein_54 | chromosome partitioning protein ParA | - |
EQB64_RS16510 | 38901..39110 | + | 210 | WP_000527318.1 | peptide-binding protein | - |
EQB64_RS16515 | 39127..39399 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
EQB64_RS16520 | 39401..40264 | + | 864 | WP_001284311.1 | toxin zeta | Toxin |
EQB64_RS16525 | 40527..41264 | - | 738 | WP_001038796.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
EQB64_RS16530 | 41389..41472 | - | 84 | WP_031929417.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
EQB64_RS16535 | 41521..41604 | - | 84 | Protein_60 | peptide-binding protein | - |
EQB64_RS16540 | 42014..42808 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
EQB64_RS16545 | 42901..43152 | - | 252 | Protein_62 | GNAT family N-acetyltransferase | - |
EQB64_RS16550 | 43397..44692 | + | 1296 | WP_002297218.1 | ISL3-like element ISEfa11 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | VanHAX / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) | - | 1..51931 | 51931 | |
- | inside | IScluster/Tn | erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) | - | 12387..51168 | 38781 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32404.02 Da Isoelectric Point: 6.9964
>T288096 WP_001284311.1 NZ_LR135247:39401-40264 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 1GVN | |
PDB | 3Q8X |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F0A3 |