Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 49336..49943 Replicon plasmid 4
Accession NZ_LR135238
Organism Enterococcus faecium isolate E7067

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag EQB63_RS15695 Protein ID WP_002321032.1
Coordinates 49593..49943 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag EQB63_RS15690 Protein ID WP_002287514.1
Coordinates 49336..49599 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB63_RS15640 44411..45004 + 594 WP_002326883.1 type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein -
EQB63_RS15645 45017..45916 + 900 WP_002326884.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
EQB63_RS15650 45919..46416 + 498 WP_002326885.1 single-stranded DNA-binding protein -
EQB63_RS15655 46782..47042 + 261 WP_002296240.1 hypothetical protein -
EQB63_RS15665 47489..47695 + 207 WP_002296239.1 hypothetical protein -
EQB63_RS15670 47695..47946 + 252 WP_002299286.1 hypothetical protein -
EQB63_RS15675 47962..48399 + 438 WP_002326886.1 hypothetical protein -
EQB63_RS15685 48844..49023 + 180 WP_002298867.1 hypothetical protein -
EQB63_RS15690 49336..49599 + 264 WP_002287514.1 hypothetical protein Antitoxin
EQB63_RS15695 49593..49943 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB63_RS15700 49967..50581 - 615 WP_002298870.1 recombinase family protein -
EQB63_RS15705 51031..52356 + 1326 WP_000969590.1 Y-family DNA polymerase -
EQB63_RS15710 52349..52699 + 351 WP_000568378.1 hypothetical protein -
EQB63_RS15715 52696..52875 + 180 WP_001021554.1 hypothetical protein -
EQB63_RS15720 53011..53301 + 291 WP_000026576.1 hypothetical protein -
EQB63_RS15725 53654..54457 + 804 WP_002311905.1 AAA family ATPase -
EQB63_RS15730 54444..54770 + 327 WP_000796719.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..55118 55118


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288087 WP_002321032.1 NZ_LR135238:49593-49943 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288087 WP_002287514.1 NZ_LR135238:49336-49599 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References