Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 19072..19722 | Replicon | plasmid 3 |
| Accession | NZ_LR135237 | ||
| Organism | Enterococcus faecium isolate E7067 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EQB63_RS15215 | Protein ID | WP_065305698.1 |
| Coordinates | 19537..19722 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A829EWE8 |
| Locus tag | EQB63_RS15210 | Protein ID | WP_002305052.1 |
| Coordinates | 19072..19503 (-) | Length | 144 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB63_RS15190 | 14773..15357 | - | 585 | WP_002299575.1 | recombinase family protein | - |
| EQB63_RS15195 | 15928..16980 | - | 1053 | WP_065305701.1 | TIGR00341 family protein | - |
| EQB63_RS15200 | 17209..17808 | + | 600 | WP_065305700.1 | recombinase family protein | - |
| EQB63_RS15205 | 17826..18887 | + | 1062 | WP_065305699.1 | hypothetical protein | - |
| EQB63_RS15210 | 19072..19503 | - | 432 | WP_002305052.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EQB63_RS15215 | 19537..19722 | - | 186 | WP_065305698.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EQB63_RS15220 | 19815..19994 | - | 180 | WP_065305697.1 | hypothetical protein | - |
| EQB63_RS15230 | 20375..21082 | - | 708 | WP_065305695.1 | hypothetical protein | - |
| EQB63_RS15235 | 21075..21512 | - | 438 | WP_065305694.1 | hypothetical protein | - |
| EQB63_RS15240 | 21527..21778 | - | 252 | WP_065305693.1 | hypothetical protein | - |
| EQB63_RS15245 | 21778..21984 | - | 207 | WP_065305692.1 | DNA helicase UvrA | - |
| EQB63_RS15250 | 22428..22688 | - | 261 | WP_049055261.1 | hypothetical protein | - |
| EQB63_RS15255 | 22763..22966 | + | 204 | WP_065305691.1 | putative holin-like toxin | - |
| EQB63_RS15260 | 23126..23383 | - | 258 | WP_065305690.1 | hypothetical protein | - |
| EQB63_RS15265 | 23405..23878 | - | 474 | WP_065305689.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..60014 | 60014 | |
| - | flank | IS/Tn | - | - | 13803..14489 | 686 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6997.21 Da Isoelectric Point: 10.8134
>T288086 WP_065305698.1 NZ_LR135237:c19722-19537 [Enterococcus faecium]
MPLTGKEMLKLLKKNGWVERRQEGSHHHLYKDGVRITVPVHANQDLGRGLERKILKDAGLK
MPLTGKEMLKLLKKNGWVERRQEGSHHHLYKDGVRITVPVHANQDLGRGLERKILKDAGLK
Download Length: 186 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 15811.92 Da Isoelectric Point: 4.1638
>AT288086 WP_002305052.1 NZ_LR135237:c19503-19072 [Enterococcus faecium]
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
Download Length: 432 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|