Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 16901..17508 Replicon plasmid 2
Accession NZ_LR135236
Organism Enterococcus faecium isolate E7067

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag EQB63_RS14240 Protein ID WP_002321032.1
Coordinates 17158..17508 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag EQB63_RS14235 Protein ID WP_002287514.1
Coordinates 16901..17164 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB63_RS14190 12009..12908 + 900 WP_002326884.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
EQB63_RS14195 12911..13384 + 474 WP_127836241.1 single-stranded DNA-binding protein -
EQB63_RS14200 13750..14010 + 261 WP_002296240.1 hypothetical protein -
EQB63_RS14205 14455..14661 + 207 WP_002325537.1 hypothetical protein -
EQB63_RS14210 14709..14912 + 204 WP_110300627.1 hypothetical protein -
EQB63_RS14215 14928..15365 + 438 WP_126341263.1 hypothetical protein -
EQB63_RS14220 15358..16065 + 708 WP_002332739.1 hypothetical protein -
EQB63_RS14230 16445..16675 + 231 WP_126341264.1 hypothetical protein -
EQB63_RS14235 16901..17164 + 264 WP_002287514.1 hypothetical protein Antitoxin
EQB63_RS14240 17158..17508 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB63_RS14245 17532..18146 - 615 WP_002318230.1 recombinase family protein -
EQB63_RS14250 18460..18882 + 423 WP_002288787.1 hypothetical protein -
EQB63_RS14255 18892..19095 + 204 WP_002299573.1 hypothetical protein -
EQB63_RS14260 19306..19896 + 591 WP_065305702.1 recombinase family protein -
EQB63_RS14265 20049..20663 + 615 WP_065305703.1 recombinase family protein -
EQB63_RS14270 20687..21856 + 1170 Protein_24 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-aph(2'') - 1..167946 167946


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288084 WP_002321032.1 NZ_LR135236:17158-17508 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288084 WP_002287514.1 NZ_LR135236:16901-17164 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References