Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 16901..17508 | Replicon | plasmid 2 |
Accession | NZ_LR135236 | ||
Organism | Enterococcus faecium isolate E7067 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | E3USU0 |
Locus tag | EQB63_RS14240 | Protein ID | WP_002321032.1 |
Coordinates | 17158..17508 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A829F3C0 |
Locus tag | EQB63_RS14235 | Protein ID | WP_002287514.1 |
Coordinates | 16901..17164 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB63_RS14190 | 12009..12908 | + | 900 | WP_002326884.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
EQB63_RS14195 | 12911..13384 | + | 474 | WP_127836241.1 | single-stranded DNA-binding protein | - |
EQB63_RS14200 | 13750..14010 | + | 261 | WP_002296240.1 | hypothetical protein | - |
EQB63_RS14205 | 14455..14661 | + | 207 | WP_002325537.1 | hypothetical protein | - |
EQB63_RS14210 | 14709..14912 | + | 204 | WP_110300627.1 | hypothetical protein | - |
EQB63_RS14215 | 14928..15365 | + | 438 | WP_126341263.1 | hypothetical protein | - |
EQB63_RS14220 | 15358..16065 | + | 708 | WP_002332739.1 | hypothetical protein | - |
EQB63_RS14230 | 16445..16675 | + | 231 | WP_126341264.1 | hypothetical protein | - |
EQB63_RS14235 | 16901..17164 | + | 264 | WP_002287514.1 | hypothetical protein | Antitoxin |
EQB63_RS14240 | 17158..17508 | + | 351 | WP_002321032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EQB63_RS14245 | 17532..18146 | - | 615 | WP_002318230.1 | recombinase family protein | - |
EQB63_RS14250 | 18460..18882 | + | 423 | WP_002288787.1 | hypothetical protein | - |
EQB63_RS14255 | 18892..19095 | + | 204 | WP_002299573.1 | hypothetical protein | - |
EQB63_RS14260 | 19306..19896 | + | 591 | WP_065305702.1 | recombinase family protein | - |
EQB63_RS14265 | 20049..20663 | + | 615 | WP_065305703.1 | recombinase family protein | - |
EQB63_RS14270 | 20687..21856 | + | 1170 | Protein_24 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(6')-aph(2'') | - | 1..167946 | 167946 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13255.28 Da Isoelectric Point: 8.0280
>T288084 WP_002321032.1 NZ_LR135236:17158-17508 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F5H8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F3C0 |