Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 48779..49386 Replicon plasmid 3
Accession NZ_LR135228
Organism Enterococcus faecium isolate E7025

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag EQB58_RS15655 Protein ID WP_002321032.1
Coordinates 49036..49386 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag EQB58_RS15650 Protein ID WP_002287514.1
Coordinates 48779..49042 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB58_RS15605 43959..44516 + 558 Protein_40 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
EQB58_RS15610 44590..45270 + 681 WP_001015311.1 IS6-like element IS1216 family transposase -
EQB58_RS15615 45418..45624 - 207 WP_002296239.1 hypothetical protein -
EQB58_RS15625 46065..46325 - 261 WP_002296240.1 hypothetical protein -
EQB58_RS15630 46691..47176 - 486 WP_099124528.1 single-stranded DNA-binding protein -
EQB58_RS15640 47378..48058 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
EQB58_RS15645 48133..48423 - 291 Protein_46 IS6-like element IS1216 family transposase -
EQB58_RS16590 48461..48625 - 165 WP_164450253.1 hypothetical protein -
EQB58_RS15650 48779..49042 + 264 WP_002287514.1 hypothetical protein Antitoxin
EQB58_RS15655 49036..49386 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB58_RS15660 49410..50024 - 615 WP_002318230.1 recombinase family protein -
EQB58_RS15665 50338..50760 + 423 WP_002288787.1 hypothetical protein -
EQB58_RS15670 50770..50973 + 204 WP_002299573.1 hypothetical protein -
EQB58_RS15675 51184..51768 + 585 WP_002299575.1 recombinase family protein -
EQB58_RS15680 52139..53464 + 1326 WP_002303115.1 Y-family DNA polymerase -
EQB58_RS15685 53457..53807 + 351 WP_002303114.1 hypothetical protein -
EQB58_RS15690 53804..53983 + 180 WP_001021554.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..56226 56226


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288079 WP_002321032.1 NZ_LR135228:49036-49386 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288079 WP_002287514.1 NZ_LR135228:48779-49042 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References