Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 48779..49386 | Replicon | plasmid 3 |
| Accession | NZ_LR135228 | ||
| Organism | Enterococcus faecium isolate E7025 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | E3USU0 |
| Locus tag | EQB58_RS15655 | Protein ID | WP_002321032.1 |
| Coordinates | 49036..49386 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A829F3C0 |
| Locus tag | EQB58_RS15650 | Protein ID | WP_002287514.1 |
| Coordinates | 48779..49042 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB58_RS15605 | 43959..44516 | + | 558 | Protein_40 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| EQB58_RS15610 | 44590..45270 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| EQB58_RS15615 | 45418..45624 | - | 207 | WP_002296239.1 | hypothetical protein | - |
| EQB58_RS15625 | 46065..46325 | - | 261 | WP_002296240.1 | hypothetical protein | - |
| EQB58_RS15630 | 46691..47176 | - | 486 | WP_099124528.1 | single-stranded DNA-binding protein | - |
| EQB58_RS15640 | 47378..48058 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| EQB58_RS15645 | 48133..48423 | - | 291 | Protein_46 | IS6-like element IS1216 family transposase | - |
| EQB58_RS16590 | 48461..48625 | - | 165 | WP_164450253.1 | hypothetical protein | - |
| EQB58_RS15650 | 48779..49042 | + | 264 | WP_002287514.1 | hypothetical protein | Antitoxin |
| EQB58_RS15655 | 49036..49386 | + | 351 | WP_002321032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EQB58_RS15660 | 49410..50024 | - | 615 | WP_002318230.1 | recombinase family protein | - |
| EQB58_RS15665 | 50338..50760 | + | 423 | WP_002288787.1 | hypothetical protein | - |
| EQB58_RS15670 | 50770..50973 | + | 204 | WP_002299573.1 | hypothetical protein | - |
| EQB58_RS15675 | 51184..51768 | + | 585 | WP_002299575.1 | recombinase family protein | - |
| EQB58_RS15680 | 52139..53464 | + | 1326 | WP_002303115.1 | Y-family DNA polymerase | - |
| EQB58_RS15685 | 53457..53807 | + | 351 | WP_002303114.1 | hypothetical protein | - |
| EQB58_RS15690 | 53804..53983 | + | 180 | WP_001021554.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..56226 | 56226 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13255.28 Da Isoelectric Point: 8.0280
>T288079 WP_002321032.1 NZ_LR135228:49036-49386 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829F5H8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829F3C0 |