Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 538989..539560 Replicon chromosome
Accession NZ_LR135226
Organism Enterococcus faecium isolate E7025

Toxin (Protein)


Gene name mazF Uniprot ID Q3Y2B8
Locus tag EQB58_RS02780 Protein ID WP_002286801.1
Coordinates 539219..539560 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A828ZZN9
Locus tag EQB58_RS02775 Protein ID WP_002323011.1
Coordinates 538989..539219 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB58_RS02740 534470..535798 + 1329 WP_002327434.1 FAD-containing oxidoreductase -
EQB58_RS02745 535820..536446 + 627 WP_002352507.1 cysteine hydrolase -
EQB58_RS02750 536629..537210 + 582 WP_002327433.1 TetR/AcrR family transcriptional regulator -
EQB58_RS02760 537575..538150 + 576 WP_002352505.1 SOS response-associated peptidase family protein -
EQB58_RS02765 538355..538693 - 339 WP_002306002.1 hypothetical protein -
EQB58_RS02775 538989..539219 + 231 WP_002323011.1 hypothetical protein Antitoxin
EQB58_RS02780 539219..539560 + 342 WP_002286801.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB58_RS02785 539895..540352 + 458 Protein_515 transposase -
EQB58_RS02790 540447..541406 + 960 WP_002301399.1 IS30 family transposase -
EQB58_RS02795 541412..542122 + 711 Protein_517 IS3-like element IS1485 family transposase -
EQB58_RS16435 542370..542495 + 126 WP_025478972.1 LPXTG cell wall anchor domain-containing protein -
EQB58_RS02805 542569..543465 + 897 WP_002352497.1 class C sortase -
EQB58_RS02810 543646..544320 + 675 WP_002291233.1 response regulator transcription factor -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 534470..544320 9850


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-113)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13302.68 Da        Isoelectric Point: 9.9044

>T288078 WP_002286801.1 NZ_LR135226:539219-539560 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8523.39 Da        Isoelectric Point: 3.9078

>AT288078 WP_002323011.1 NZ_LR135226:538989-539219 [Enterococcus faecium]
MLVTKSRLQGSSVVVTLPSDNGKKPSENQEYIVVYSDDGTITLVPKIEDPFSGGEEAEYYEKDEWEDLTPEGREIL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FD66

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZZN9

References