Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 23938..24562 | Replicon | plasmid 5 |
| Accession | NZ_LR135223 | ||
| Organism | Enterococcus faecium isolate E7040 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | - |
| Locus tag | EQB60_RS15975 | Protein ID | WP_127822567.1 |
| Coordinates | 24212..24562 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | R2XCR7 |
| Locus tag | EQB60_RS15970 | Protein ID | WP_000301765.1 |
| Coordinates | 23938..24210 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB60_RS15945 | 20436..21929 | + | 1494 | WP_000947691.1 | primase C-terminal domain-containing protein | - |
| EQB60_RS15950 | 22064..22360 | + | 297 | WP_000053907.1 | replication control protein PrgN | - |
| EQB60_RS15955 | 22384..23343 | - | 960 | WP_002287225.1 | IS30 family transposase | - |
| EQB60_RS15960 | 23363..23614 | + | 252 | Protein_33 | chromosome partitioning protein ParA | - |
| EQB60_RS15965 | 23712..23921 | + | 210 | WP_000527318.1 | peptide-binding protein | - |
| EQB60_RS15970 | 23938..24210 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
| EQB60_RS15975 | 24212..24562 | + | 351 | WP_127822567.1 | zeta toxin family protein | Toxin |
| EQB60_RS15980 | 24596..25276 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| EQB60_RS15985 | 25608..26576 | + | 969 | WP_001059542.1 | D-lactate dehydrogenase VanH-A | - |
| EQB60_RS15990 | 26569..27600 | + | 1032 | WP_001079845.1 | D-alanine--(R)-lactate ligase VanA | - |
| EQB60_RS15995 | 27606..28214 | + | 609 | WP_000402347.1 | D-Ala-D-Ala dipeptidase VanX-A | - |
| EQB60_RS16000 | 28484..29164 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | VanHAX | - | 1..38599 | 38599 | |
| - | inside | IScluster/Tn | VanHAX | - | 2042..29164 | 27122 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12959.56 Da Isoelectric Point: 5.1679
>T288076 WP_127822567.1 NZ_LR135223:24212-24562 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGGSVAKF
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGGSVAKF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3Q8X | |
| PDB | 1GVN | |
| AlphaFold DB | A0A829F0A3 |