Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 98798..99317 Replicon plasmid 3
Accession NZ_LR135221
Organism Enterococcus faecium isolate E7040

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag EQB60_RS15365 Protein ID WP_000588503.1
Coordinates 99060..99317 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag EQB60_RS15360 Protein ID WP_000388479.1
Coordinates 98798..99067 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB60_RS15305 93995..94894 + 900 WP_002303312.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
EQB60_RS15310 94897..95382 + 486 WP_002303313.1 single-stranded DNA-binding protein -
EQB60_RS15315 95523..95726 - 204 WP_002316074.1 putative holin-like toxin -
EQB60_RS15320 95801..96061 + 261 WP_002295623.1 hypothetical protein -
EQB60_RS15330 96498..96704 + 207 WP_002347218.1 hypothetical protein -
EQB60_RS15335 96704..96955 + 252 WP_002296238.1 hypothetical protein -
EQB60_RS15340 96970..97407 + 438 WP_002300851.1 hypothetical protein -
EQB60_RS15345 97400..98107 + 708 WP_002303117.1 hypothetical protein -
EQB60_RS15355 98488..98667 + 180 WP_001120991.1 hypothetical protein -
EQB60_RS15360 98798..99067 + 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EQB60_RS15365 99060..99317 + 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
EQB60_RS16415 99776..99931 + 156 WP_002347142.1 hypothetical protein -
EQB60_RS15370 99955..100779 + 825 WP_001809248.1 hypothetical protein -
EQB60_RS15375 100944..101558 - 615 WP_001261742.1 recombinase family protein -
EQB60_RS15380 101796..102218 + 423 WP_002288787.1 hypothetical protein -
EQB60_RS15385 102228..102431 + 204 WP_002299573.1 hypothetical protein -
EQB60_RS15390 102642..103226 + 585 WP_002299575.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(M) / tet(L) / ant(6)-Ia / cat(pC194) / erm(T) - 1..114941 114941


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T288074 WP_000588503.1 NZ_LR135221:99060-99317 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT288074 WP_000388479.1 NZ_LR135221:98798-99067 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References