Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
| Location | 65460..66568 | Replicon | plasmid 3 |
| Accession | NZ_LR135221 | ||
| Organism | Enterococcus faecium isolate E7040 | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | R3JIN1 |
| Locus tag | EQB60_RS15165 | Protein ID | WP_000233000.1 |
| Coordinates | 65460..66329 (-) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | - |
| Locus tag | EQB60_RS15170 | Protein ID | WP_000205227.1 |
| Coordinates | 66344..66568 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB60_RS15140 | 60569..61540 | - | 972 | Protein_68 | type IA DNA topoisomerase | - |
| EQB60_RS15145 | 61731..63050 | - | 1320 | WP_002338419.1 | IS1380-like element ISSsu5 family transposase | - |
| EQB60_RS15150 | 63278..63805 | - | 528 | WP_002294507.1 | adenine phosphoribosyltransferase | - |
| EQB60_RS15155 | 63849..64712 | - | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| EQB60_RS15160 | 64745..65479 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
| EQB60_RS15165 | 65460..66329 | - | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
| EQB60_RS15170 | 66344..66568 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| EQB60_RS15175 | 66711..68273 | - | 1563 | WP_000136908.1 | recombinase family protein | - |
| EQB60_RS15180 | 68275..68691 | - | 417 | WP_000323438.1 | recombinase | - |
| EQB60_RS15185 | 68692..68988 | - | 297 | WP_002360685.1 | hypothetical protein | - |
| EQB60_RS15190 | 69513..70700 | - | 1188 | WP_002296840.1 | IS256-like element IS16 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(M) / tet(L) / ant(6)-Ia / cat(pC194) / erm(T) | - | 1..114941 | 114941 | |
| - | inside | IScluster/Tn | ant(6)-Ia / cat(pC194) / erm(T) | - | 61731..86769 | 25038 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T288073 WP_000233000.1 NZ_LR135221:c66329-65460 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|