Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 16925..17532 | Replicon | plasmid 2 |
Accession | NZ_LR135220 | ||
Organism | Enterococcus faecium isolate E7040 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | E3USU0 |
Locus tag | EQB60_RS13960 | Protein ID | WP_002321032.1 |
Coordinates | 17182..17532 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A829F3C0 |
Locus tag | EQB60_RS13955 | Protein ID | WP_002287514.1 |
Coordinates | 16925..17188 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB60_RS13910 | 12009..12908 | + | 900 | WP_010733696.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
EQB60_RS13915 | 12911..13408 | + | 498 | WP_002326885.1 | single-stranded DNA-binding protein | - |
EQB60_RS13920 | 13774..14034 | + | 261 | WP_002296240.1 | hypothetical protein | - |
EQB60_RS13925 | 14479..14685 | + | 207 | WP_002325537.1 | hypothetical protein | - |
EQB60_RS13930 | 14733..14936 | + | 204 | WP_110300627.1 | hypothetical protein | - |
EQB60_RS13935 | 14952..15389 | + | 438 | WP_126341263.1 | hypothetical protein | - |
EQB60_RS13940 | 15382..16089 | + | 708 | WP_002332739.1 | hypothetical protein | - |
EQB60_RS13950 | 16469..16699 | + | 231 | WP_126341264.1 | hypothetical protein | - |
EQB60_RS13955 | 16925..17188 | + | 264 | WP_002287514.1 | hypothetical protein | Antitoxin |
EQB60_RS13960 | 17182..17532 | + | 351 | WP_002321032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EQB60_RS13965 | 17556..18170 | - | 615 | WP_002318230.1 | recombinase family protein | - |
EQB60_RS13970 | 18484..18906 | + | 423 | WP_002288787.1 | hypothetical protein | - |
EQB60_RS13975 | 18916..19119 | + | 204 | WP_002299573.1 | hypothetical protein | - |
EQB60_RS13980 | 19330..19920 | + | 591 | WP_065305702.1 | recombinase family protein | - |
EQB60_RS13985 | 20073..20687 | + | 615 | WP_065305703.1 | recombinase family protein | - |
EQB60_RS13990 | 20711..21880 | + | 1170 | Protein_24 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(6')-aph(2'') / aph(2'')-Ia | - | 1..165514 | 165514 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13255.28 Da Isoelectric Point: 8.0280
>T288071 WP_002321032.1 NZ_LR135220:17182-17532 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F5H8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F3C0 |