Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 22499..23106 | Replicon | plasmid 5 |
Accession | NZ_LR135207 | ||
Organism | Enterococcus faecium isolate E7171 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | E3USU0 |
Locus tag | EQB62_RS16465 | Protein ID | WP_002321032.1 |
Coordinates | 22756..23106 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A829F3C0 |
Locus tag | EQB62_RS16460 | Protein ID | WP_002287514.1 |
Coordinates | 22499..22762 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB62_RS16425 | 18579..19259 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
EQB62_RS16430 | 19407..19613 | - | 207 | WP_002296239.1 | hypothetical protein | - |
EQB62_RS16440 | 20054..20314 | - | 261 | WP_002296240.1 | hypothetical protein | - |
EQB62_RS16445 | 20680..21090 | - | 411 | WP_127824148.1 | single-stranded DNA-binding protein | - |
EQB62_RS16450 | 21132..21812 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
EQB62_RS16455 | 21886..22143 | - | 258 | Protein_23 | IS6 family transposase | - |
EQB62_RS16760 | 22181..22345 | - | 165 | WP_164450253.1 | hypothetical protein | - |
EQB62_RS16460 | 22499..22762 | + | 264 | WP_002287514.1 | hypothetical protein | Antitoxin |
EQB62_RS16465 | 22756..23106 | + | 351 | WP_002321032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EQB62_RS16470 | 23130..23744 | - | 615 | WP_002318230.1 | recombinase family protein | - |
EQB62_RS16475 | 24058..24480 | + | 423 | WP_002288787.1 | hypothetical protein | - |
EQB62_RS16480 | 24490..24693 | + | 204 | WP_002299573.1 | hypothetical protein | - |
EQB62_RS16485 | 24904..25488 | + | 585 | WP_002299575.1 | recombinase family protein | - |
EQB62_RS16490 | 25859..27184 | + | 1326 | WP_002303115.1 | Y-family DNA polymerase | - |
EQB62_RS16495 | 27177..27527 | + | 351 | WP_002303114.1 | hypothetical protein | - |
EQB62_RS16500 | 27524..27703 | + | 180 | WP_001021554.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..29946 | 29946 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13255.28 Da Isoelectric Point: 8.0280
>T288068 WP_002321032.1 NZ_LR135207:22756-23106 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F5H8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F3C0 |