Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 22499..23106 Replicon plasmid 5
Accession NZ_LR135207
Organism Enterococcus faecium isolate E7171

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag EQB62_RS16465 Protein ID WP_002321032.1
Coordinates 22756..23106 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag EQB62_RS16460 Protein ID WP_002287514.1
Coordinates 22499..22762 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB62_RS16425 18579..19259 + 681 WP_001015311.1 IS6-like element IS1216 family transposase -
EQB62_RS16430 19407..19613 - 207 WP_002296239.1 hypothetical protein -
EQB62_RS16440 20054..20314 - 261 WP_002296240.1 hypothetical protein -
EQB62_RS16445 20680..21090 - 411 WP_127824148.1 single-stranded DNA-binding protein -
EQB62_RS16450 21132..21812 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
EQB62_RS16455 21886..22143 - 258 Protein_23 IS6 family transposase -
EQB62_RS16760 22181..22345 - 165 WP_164450253.1 hypothetical protein -
EQB62_RS16460 22499..22762 + 264 WP_002287514.1 hypothetical protein Antitoxin
EQB62_RS16465 22756..23106 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB62_RS16470 23130..23744 - 615 WP_002318230.1 recombinase family protein -
EQB62_RS16475 24058..24480 + 423 WP_002288787.1 hypothetical protein -
EQB62_RS16480 24490..24693 + 204 WP_002299573.1 hypothetical protein -
EQB62_RS16485 24904..25488 + 585 WP_002299575.1 recombinase family protein -
EQB62_RS16490 25859..27184 + 1326 WP_002303115.1 Y-family DNA polymerase -
EQB62_RS16495 27177..27527 + 351 WP_002303114.1 hypothetical protein -
EQB62_RS16500 27524..27703 + 180 WP_001021554.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..29946 29946


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288068 WP_002321032.1 NZ_LR135207:22756-23106 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288068 WP_002287514.1 NZ_LR135207:22499-22762 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References