Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 2690..3314 | Replicon | plasmid 4 |
Accession | NZ_LR135206 | ||
Organism | Enterococcus faecium isolate E7171 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | EQB62_RS16055 | Protein ID | WP_127822567.1 |
Coordinates | 2690..3040 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | EQB62_RS16060 | Protein ID | WP_000301765.1 |
Coordinates | 3042..3314 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB62_RS16040 | 1..683 | - | 683 | WP_127824146.1 | D-alanine--(R)-lactate ligase VanA | - |
EQB62_RS16045 | 676..1644 | - | 969 | WP_001059542.1 | D-lactate dehydrogenase VanH-A | - |
EQB62_RS16050 | 1976..2656 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
EQB62_RS16055 | 2690..3040 | - | 351 | WP_127822567.1 | zeta toxin family protein | Toxin |
EQB62_RS16060 | 3042..3314 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
EQB62_RS16065 | 3331..3540 | - | 210 | WP_000527318.1 | peptide-binding protein | - |
EQB62_RS16070 | 3638..3889 | - | 252 | Protein_6 | chromosome partitioning protein ParA | - |
EQB62_RS16075 | 3909..4868 | + | 960 | WP_002287225.1 | IS30 family transposase | - |
EQB62_RS16080 | 4892..5188 | - | 297 | WP_000053907.1 | replication control protein PrgN | - |
EQB62_RS16085 | 5323..6816 | - | 1494 | WP_000947691.1 | primase C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..38582 | 38582 | |
- | inside | IScluster/Tn | - | - | 1976..29152 | 27176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12959.56 Da Isoelectric Point: 5.1679
>T288067 WP_127822567.1 NZ_LR135206:c3040-2690 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGGSVAKF
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGGSVAKF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|