Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 95209..95878 | Replicon | plasmid 2 |
| Accession | NZ_LR135204 | ||
| Organism | Enterococcus faecium isolate E7171 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | - |
| Locus tag | EQB62_RS15015 | Protein ID | WP_010708525.1 |
| Coordinates | 95483..95878 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL01 |
| Locus tag | EQB62_RS15010 | Protein ID | WP_002331065.1 |
| Coordinates | 95209..95481 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB62_RS14970 | 90508..91416 | + | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| EQB62_RS14975 | 91413..91955 | + | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
| EQB62_RS14980 | 92048..92842 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
| EQB62_RS14990 | 93118..93690 | + | 573 | WP_001079938.1 | HTH domain-containing protein | - |
| EQB62_RS15000 | 93988..94884 | + | 897 | WP_002334978.1 | ParA family protein | - |
| EQB62_RS15005 | 94983..95192 | + | 210 | WP_000527318.1 | peptide-binding protein | - |
| EQB62_RS15010 | 95209..95481 | + | 273 | WP_002331065.1 | antitoxin | Antitoxin |
| EQB62_RS15015 | 95483..95878 | + | 396 | WP_010708525.1 | zeta toxin family protein | Toxin |
| EQB62_RS15020 | 95906..96586 | + | 681 | Protein_111 | IS6 family transposase | - |
| EQB62_RS15025 | 96638..96784 | + | 147 | Protein_112 | Txe/YoeB family addiction module toxin | - |
| EQB62_RS15030 | 96861..97190 | + | 330 | WP_002292678.1 | AbrB family transcriptional regulator | - |
| EQB62_RS15035 | 97180..97467 | + | 288 | WP_002300557.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| EQB62_RS15040 | 97753..98610 | + | 858 | WP_002292680.1 | AAA family ATPase | - |
| EQB62_RS15045 | 98611..99159 | + | 549 | WP_002292681.1 | hypothetical protein | - |
| EQB62_RS15050 | 99419..100147 | + | 729 | WP_010726886.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | erm(B) / ant(6)-Ia / aph(3')-III / aac(6')-aph(2'') | - | 1..231143 | 231143 | |
| - | inside | IScluster/Tn | erm(B) / ant(6)-Ia / aph(3')-III | - | 86512..101768 | 15256 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14867.86 Da Isoelectric Point: 5.2505
>T288066 WP_010708525.1 NZ_LR135204:95483-95878 [Enterococcus faecium]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGFCCKVLNLLSNKVE
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGFCCKVLNLLSNKVE
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|