Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 44675..45325 | Replicon | plasmid 2 |
| Accession | NZ_LR135204 | ||
| Organism | Enterococcus faecium isolate E7171 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EQB62_RS14660 | Protein ID | WP_002332741.1 |
| Coordinates | 44675..44860 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A829EWE8 |
| Locus tag | EQB62_RS14665 | Protein ID | WP_002305052.1 |
| Coordinates | 44894..45325 (+) | Length | 144 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB62_RS14615 | 39980..40879 | + | 900 | WP_014401509.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| EQB62_RS14620 | 40882..41367 | + | 486 | WP_014401510.1 | single-stranded DNA-binding protein | - |
| EQB62_RS14625 | 41733..41993 | + | 261 | WP_002296240.1 | hypothetical protein | - |
| EQB62_RS14630 | 42440..42646 | + | 207 | WP_002296239.1 | hypothetical protein | - |
| EQB62_RS14635 | 42646..42870 | + | 225 | WP_020944759.1 | hypothetical protein | - |
| EQB62_RS14640 | 42885..43322 | + | 438 | WP_020944760.1 | hypothetical protein | - |
| EQB62_RS14645 | 43315..44022 | + | 708 | WP_020944761.1 | hypothetical protein | - |
| EQB62_RS14655 | 44403..44582 | + | 180 | WP_002295613.1 | hypothetical protein | - |
| EQB62_RS14660 | 44675..44860 | + | 186 | WP_002332741.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EQB62_RS14665 | 44894..45325 | + | 432 | WP_002305052.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EQB62_RS14675 | 46262..46492 | + | 231 | Protein_47 | MFS transporter | - |
| EQB62_RS14680 | 46544..47224 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| EQB62_RS14685 | 47300..48217 | - | 918 | Protein_49 | oligosaccharide MFS transporter | - |
| EQB62_RS14690 | 48294..48974 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | erm(B) / ant(6)-Ia / aph(3')-III / aac(6')-aph(2'') | - | 1..231143 | 231143 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6969.15 Da Isoelectric Point: 10.6196
>T288064 WP_002332741.1 NZ_LR135204:44675-44860 [Enterococcus faecium]
MPLTGKEMLKLLKKNGWVERRQEGSHHHLYKDGVRITVPVHANQDLGRGLEQKILKDAGLK
MPLTGKEMLKLLKKNGWVERRQEGSHHHLYKDGVRITVPVHANQDLGRGLEQKILKDAGLK
Download Length: 186 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 15811.92 Da Isoelectric Point: 4.1638
>AT288064 WP_002305052.1 NZ_LR135204:44894-45325 [Enterococcus faecium]
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
Download Length: 432 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|