Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 49943..50593 | Replicon | plasmid 3 |
| Accession | NZ_LR135193 | ||
| Organism | Enterococcus faecium isolate E4438 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EL354_RS15055 | Protein ID | WP_002332741.1 |
| Coordinates | 49943..50128 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A829EWE8 |
| Locus tag | EL354_RS15060 | Protein ID | WP_002305052.1 |
| Coordinates | 50162..50593 (+) | Length | 144 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL354_RS15010 | 45222..46121 | + | 900 | WP_126309539.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| EL354_RS15015 | 46124..46609 | + | 486 | WP_010726737.1 | single-stranded DNA-binding protein | - |
| EL354_RS15020 | 46975..47235 | + | 261 | WP_002296240.1 | hypothetical protein | - |
| EL354_RS15025 | 47680..47886 | + | 207 | WP_002325537.1 | hypothetical protein | - |
| EL354_RS15030 | 47934..48137 | + | 204 | WP_110300627.1 | hypothetical protein | - |
| EL354_RS15035 | 48153..48590 | + | 438 | WP_002332738.1 | hypothetical protein | - |
| EL354_RS15040 | 48583..49290 | + | 708 | WP_002332739.1 | hypothetical protein | - |
| EL354_RS15050 | 49671..49850 | + | 180 | WP_002332740.1 | hypothetical protein | - |
| EL354_RS15055 | 49943..50128 | + | 186 | WP_002332741.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL354_RS15060 | 50162..50593 | + | 432 | WP_002305052.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL354_RS15070 | 51530..52804 | + | 1275 | WP_002323715.1 | MFS transporter | - |
| EL354_RS15075 | 52858..54285 | + | 1428 | WP_002332665.1 | sucrose-6-phosphate hydrolase | - |
| EL354_RS15080 | 54298..55170 | + | 873 | WP_002332664.1 | ROK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..64154 | 64154 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6969.15 Da Isoelectric Point: 10.6196
>T288058 WP_002332741.1 NZ_LR135193:49943-50128 [Enterococcus faecium]
MPLTGKEMLKLLKKNGWVERRQEGSHHHLYKDGVRITVPVHANQDLGRGLEQKILKDAGLK
MPLTGKEMLKLLKKNGWVERRQEGSHHHLYKDGVRITVPVHANQDLGRGLEQKILKDAGLK
Download Length: 186 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 15811.92 Da Isoelectric Point: 4.1638
>AT288058 WP_002305052.1 NZ_LR135193:50162-50593 [Enterococcus faecium]
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
Download Length: 432 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|