Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 92711..93282 | Replicon | plasmid 2 |
Accession | NZ_LR135192 | ||
Organism | Enterococcus faecium isolate E4438 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | EL354_RS14535 | Protein ID | WP_002322675.1 |
Coordinates | 92941..93282 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | EL354_RS14530 | Protein ID | WP_002322676.1 |
Coordinates | 92711..92941 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL354_RS14505 | 87783..88337 | - | 555 | WP_002295761.1 | tyrosine-type recombinase/integrase | - |
EL354_RS14510 | 89080..89640 | + | 561 | WP_002347210.1 | hypothetical protein | - |
EL354_RS14515 | 89673..90485 | - | 813 | WP_002322679.1 | AAA family ATPase | - |
EL354_RS14520 | 90478..91914 | - | 1437 | WP_002322678.1 | DDE-type integrase/transposase/recombinase | - |
EL354_RS14525 | 91886..92479 | - | 594 | WP_002322677.1 | recombinase family protein | - |
EL354_RS14530 | 92711..92941 | + | 231 | WP_002322676.1 | hypothetical protein | Antitoxin |
EL354_RS14535 | 92941..93282 | + | 342 | WP_002322675.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL354_RS14540 | 93496..94998 | - | 1503 | WP_002322674.1 | xylulokinase | - |
EL354_RS14545 | 95071..96123 | - | 1053 | WP_002323515.1 | sugar ABC transporter substrate-binding protein | - |
EL354_RS14550 | 96176..97144 | - | 969 | WP_002322672.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..145361 | 145361 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13232.43 Da Isoelectric Point: 9.4128
>T288056 WP_002322675.1 NZ_LR135192:92941-93282 [Enterococcus faecium]
MTEEKNYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIRNFPTRYSLPTELDTTGQILISQ
LKSLDFNERKLKKIESLPLQDMAKIDQMIEYIF
MTEEKNYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIRNFPTRYSLPTELDTTGQILISQ
LKSLDFNERKLKKIESLPLQDMAKIDQMIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|