Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 516681..517252 | Replicon | chromosome |
Accession | NZ_LR135191 | ||
Organism | Enterococcus faecium isolate E4438 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q3Y2B8 |
Locus tag | EL354_RS02605 | Protein ID | WP_002286801.1 |
Coordinates | 516911..517252 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | EL354_RS02600 | Protein ID | WP_002323011.1 |
Coordinates | 516681..516911 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL354_RS02560 | 512047..513378 | + | 1332 | WP_002330022.1 | FAD-containing oxidoreductase | - |
EL354_RS02565 | 513400..514026 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
EL354_RS02570 | 514209..514790 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
EL354_RS02585 | 515276..515851 | + | 576 | WP_002293673.1 | SOS response-associated peptidase family protein | - |
EL354_RS02590 | 516056..516394 | - | 339 | WP_002286804.1 | hypothetical protein | - |
EL354_RS02600 | 516681..516911 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
EL354_RS02605 | 516911..517252 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL354_RS02610 | 517820..518982 | + | 1163 | WP_086956687.1 | IS3 family transposase | - |
EL354_RS02620 | 519237..519431 | + | 195 | WP_002295146.1 | hypothetical protein | - |
EL354_RS02625 | 519589..519871 | + | 283 | Protein_490 | transposase | - |
EL354_RS02635 | 520115..520945 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T288055 WP_002286801.1 NZ_LR135191:516911-517252 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FD66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |