Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 18183..19291 | Replicon | plasmid 3 |
Accession | NZ_LR135183 | ||
Organism | Enterococcus faecium isolate E1774 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | R3JIN1 |
Locus tag | EL353_RS14825 | Protein ID | WP_000233000.1 |
Coordinates | 18183..19052 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | EL353_RS14830 | Protein ID | WP_000205227.1 |
Coordinates | 19067..19291 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL353_RS14790 | 13436..13999 | - | 564 | Protein_13 | zinc ribbon domain-containing protein | - |
EL353_RS14795 | 14082..14540 | + | 459 | WP_002325145.1 | hypothetical protein | - |
EL353_RS14800 | 14591..14842 | - | 252 | WP_002294510.1 | hypothetical protein | - |
EL353_RS14805 | 15060..15869 | - | 810 | WP_002294509.1 | ANT(9) family aminoglycoside nucleotidyltransferase Spw | - |
EL353_RS14810 | 16001..16528 | - | 528 | WP_002294507.1 | adenine phosphoribosyltransferase | - |
EL353_RS14815 | 16572..17435 | - | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
EL353_RS14820 | 17468..18202 | - | 735 | WP_010733554.1 | class I SAM-dependent methyltransferase | - |
EL353_RS14825 | 18183..19052 | - | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
EL353_RS14830 | 19067..19291 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
EL353_RS14835 | 19434..20996 | - | 1563 | WP_000136908.1 | recombinase family protein | - |
EL353_RS14840 | 20998..21414 | - | 417 | WP_000323438.1 | recombinase | - |
EL353_RS14845 | 21415..21711 | - | 297 | WP_002360685.1 | hypothetical protein | - |
EL353_RS14850 | 22223..22900 | - | 678 | Protein_25 | DNA topoisomerase | - |
EL353_RS14855 | 22916..23518 | - | 603 | WP_001062586.1 | recombinase family protein | - |
EL353_RS15120 | 23532..23702 | - | 171 | WP_000713595.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T288053 WP_000233000.1 NZ_LR135183:c19052-18183 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|